Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
Location | 1381725..1382363 | Replicon | chromosome |
Accession | NZ_CP102380 | ||
Organism | Escherichia coli strain BM28 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | S1F9G9 |
Locus tag | NR349_RS06735 | Protein ID | WP_000813794.1 |
Coordinates | 1381725..1381901 (+) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | NR349_RS06740 | Protein ID | WP_001270286.1 |
Coordinates | 1381947..1382363 (+) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NR349_RS06715 (1377345) | 1377345..1378519 | - | 1175 | Protein_1307 | BenE family transporter YdcO | - |
NR349_RS06720 (1378611) | 1378611..1379147 | + | 537 | WP_000429155.1 | DNA-binding transcriptional regulator SutR | - |
NR349_RS06725 (1379220) | 1379220..1381181 | + | 1962 | WP_001303492.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
NR349_RS06730 (1381273) | 1381273..1381503 | - | 231 | WP_000494244.1 | YncJ family protein | - |
NR349_RS06735 (1381725) | 1381725..1381901 | + | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
NR349_RS06740 (1381947) | 1381947..1382363 | + | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
NR349_RS06745 (1382442) | 1382442..1383848 | + | 1407 | WP_000760626.1 | PLP-dependent aminotransferase family protein | - |
NR349_RS06750 (1384093) | 1384093..1385238 | + | 1146 | WP_000047424.1 | ABC transporter substrate-binding protein | - |
NR349_RS06755 (1385256) | 1385256..1386269 | + | 1014 | WP_000220396.1 | ABC transporter ATP-binding protein | - |
NR349_RS06760 (1386270) | 1386270..1387211 | + | 942 | WP_001251304.1 | ABC transporter permease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T253573 WP_000813794.1 NZ_CP102380:1381725-1381901 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT253573 WP_001270286.1 NZ_CP102380:1381947-1382363 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|