Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | chpSB/PRK09812-ChpS |
Location | 4324232..4324827 | Replicon | chromosome |
Accession | NZ_CP102379 | ||
Organism | Escherichia coli strain BM28 lysU |
Toxin (Protein)
Gene name | chpB | Uniprot ID | U9XNP6 |
Locus tag | NR350_RS20945 | Protein ID | WP_000239577.1 |
Coordinates | 4324477..4324827 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | chpS | Uniprot ID | U9Y2K1 |
Locus tag | NR350_RS20940 | Protein ID | WP_001223208.1 |
Coordinates | 4324232..4324483 (+) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NR350_RS20930 (4319897) | 4319897..4323676 | + | 3780 | WP_262515045.1 | autotransporter assembly complex protein TamB | - |
NR350_RS20935 (4323679) | 4323679..4324020 | + | 342 | WP_001219160.1 | gamma-glutamylcyclotransferase | - |
NR350_RS20940 (4324232) | 4324232..4324483 | + | 252 | WP_001223208.1 | type II toxin-antitoxin system antitoxin ChpS | Antitoxin |
NR350_RS20945 (4324477) | 4324477..4324827 | + | 351 | WP_000239577.1 | endoribonuclease toxin ChpB | Toxin |
NR350_RS20950 (4324907) | 4324907..4325437 | - | 531 | WP_000055075.1 | inorganic diphosphatase | - |
NR350_RS20955 (4325747) | 4325747..4326703 | + | 957 | WP_000265913.1 | galactofuranose ABC transporter substrate-binding protein YtfQ | - |
NR350_RS20960 (4326843) | 4326843..4328345 | + | 1503 | WP_000205805.1 | sugar ABC transporter ATP-binding protein | - |
NR350_RS20965 (4328359) | 4328359..4329381 | + | 1023 | WP_001313531.1 | ABC transporter permease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12492.40 Da Isoelectric Point: 5.5572
>T253556 WP_000239577.1 NZ_CP102379:4324477-4324827 [Escherichia coli]
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLHARLAKRIGLAADEVVEEALLRLQAVVE
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLHARLAKRIGLAADEVVEEALLRLQAVVE
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | U9XNP6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9LQ26 |