Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 2910184..2910838 | Replicon | chromosome |
Accession | NZ_CP102379 | ||
Organism | Escherichia coli strain BM28 lysU |
Toxin (Protein)
Gene name | cptA | Uniprot ID | S1EEB2 |
Locus tag | NR350_RS14160 | Protein ID | WP_000244777.1 |
Coordinates | 2910184..2910591 (-) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S1PPB1 |
Locus tag | NR350_RS14165 | Protein ID | WP_000354046.1 |
Coordinates | 2910572..2910838 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NR350_RS14140 (2906141) | 2906141..2907874 | - | 1734 | WP_000813200.1 | single-stranded-DNA-specific exonuclease RecJ | - |
NR350_RS14145 (2907880) | 2907880..2908590 | - | 711 | WP_000715214.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
NR350_RS14150 (2908615) | 2908615..2909511 | - | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
NR350_RS14155 (2909623) | 2909623..2910144 | + | 522 | WP_001055874.1 | flavodoxin FldB | - |
NR350_RS14160 (2910184) | 2910184..2910591 | - | 408 | WP_000244777.1 | protein YgfX | Toxin |
NR350_RS14165 (2910572) | 2910572..2910838 | - | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
NR350_RS14170 (2911081) | 2911081..2912061 | + | 981 | WP_000886062.1 | tRNA-modifying protein YgfZ | - |
NR350_RS14175 (2912257) | 2912257..2912916 | - | 660 | WP_000250274.1 | hemolysin III family protein | - |
NR350_RS14180 (2913080) | 2913080..2913391 | - | 312 | WP_001182957.1 | N(4)-acetylcytidine aminohydrolase | - |
NR350_RS14185 (2913436) | 2913436..2914869 | + | 1434 | WP_001336277.1 | 6-phospho-beta-glucosidase BglA | - |
NR350_RS14190 (2914926) | 2914926..2915669 | - | 744 | WP_000951964.1 | SDR family oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16031.96 Da Isoelectric Point: 11.5202
>T253551 WP_000244777.1 NZ_CP102379:c2910591-2910184 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9LFV7 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 6B58 | |
PDB | 1X6I | |
PDB | 1X6J | |
PDB | 6C12 | |
AlphaFold DB | A0A7U9QD57 |