Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yfjZ-ypjF/CbtA-CbeA |
| Location | 2646884..2647551 | Replicon | chromosome |
| Accession | NZ_CP102379 | ||
| Organism | Escherichia coli strain BM28 lysU | ||
Toxin (Protein)
| Gene name | ypjF | Uniprot ID | Q46953 |
| Locus tag | NR350_RS12945 | Protein ID | WP_001094400.1 |
| Coordinates | 2647222..2647551 (+) | Length | 110 a.a. |
Antitoxin (Protein)
| Gene name | yfjZ | Uniprot ID | P52141 |
| Locus tag | NR350_RS12940 | Protein ID | WP_000072690.1 |
| Coordinates | 2646884..2647201 (+) | Length | 106 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NR350_RS12910 (2641936) | 2641936..2642945 | - | 1010 | Protein_2521 | arsenic transporter | - |
| NR350_RS12915 (2643087) | 2643087..2644790 | + | 1704 | WP_000896263.1 | protein YfjW | - |
| NR350_RS12920 (2645362) | 2645362..2645585 | + | 224 | Protein_2523 | DUF905 domain-containing protein | - |
| NR350_RS12925 (2645688) | 2645688..2646146 | + | 459 | WP_000211841.1 | antirestriction protein | - |
| NR350_RS12930 (2646155) | 2646155..2646637 | + | 483 | WP_001407480.1 | RadC family protein | - |
| NR350_RS12935 (2646646) | 2646646..2646846 | + | 201 | WP_001395452.1 | DUF987 domain-containing protein | - |
| NR350_RS12940 (2646884) | 2646884..2647201 | + | 318 | WP_000072690.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| NR350_RS12945 (2647222) | 2647222..2647551 | + | 330 | WP_001094400.1 | type IV toxin-antitoxin system toxin YpjF | Toxin |
| NR350_RS12950 (2647915) | 2647915..2652493 | - | 4579 | Protein_2529 | adhesin-like autotransporter YpjA/EhaD | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 110 a.a. Molecular weight: 12308.21 Da Isoelectric Point: 7.2761
>T253549 WP_001094400.1 NZ_CP102379:2647222-2647551 [Escherichia coli]
MNTLPATISQAAKPCLSPVAVWQMLLTRLLEQHYGLTLNDTPFSDETVIKEHIDAGITLADAVNFLVEKYELVRIDHRGF
SWQQQSPYISVVDILRARRSTGLLKTNVK
MNTLPATISQAAKPCLSPVAVWQMLLTRLLEQHYGLTLNDTPFSDETVIKEHIDAGITLADAVNFLVEKYELVRIDHRGF
SWQQQSPYISVVDILRARRSTGLLKTNVK
Download Length: 330 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A373F4I3 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 2EA9 | |
| PDB | 2JN7 | |
| AlphaFold DB | P52141 |