Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 1954123..1954954 | Replicon | chromosome |
Accession | NZ_CP102379 | ||
Organism | Escherichia coli strain BM28 lysU |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | S1P968 |
Locus tag | NR350_RS09675 | Protein ID | WP_000854814.1 |
Coordinates | 1954580..1954954 (+) | Length | 125 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | P76364 |
Locus tag | NR350_RS09670 | Protein ID | WP_001285584.1 |
Coordinates | 1954123..1954491 (+) | Length | 123 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NR350_RS09655 (1951790) | 1951790..1953322 | + | 1533 | WP_001350525.1 | protein YeeR | - |
NR350_RS09660 (1953319) | 1953319..1953765 | + | 447 | WP_000187523.1 | RadC family protein | - |
NR350_RS09665 (1953828) | 1953828..1954049 | + | 222 | WP_000692323.1 | DUF987 domain-containing protein | - |
NR350_RS09670 (1954123) | 1954123..1954491 | + | 369 | WP_001285584.1 | type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA | Antitoxin |
NR350_RS09675 (1954580) | 1954580..1954954 | + | 375 | WP_000854814.1 | type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA | Toxin |
NR350_RS09680 (1954951) | 1954951..1955145 | + | 195 | WP_000988600.1 | DUF5983 family protein | - |
NR350_RS09685 (1955191) | 1955191..1955271 | + | 81 | Protein_1890 | hypothetical protein | - |
NR350_RS09690 (1955560) | 1955560..1955688 | - | 129 | Protein_1891 | transposase domain-containing protein | - |
NR350_RS09695 (1955808) | 1955808..1955942 | + | 135 | WP_001297944.1 | EutP/PduV family microcompartment system protein | - |
NR350_RS09700 (1956043) | 1956043..1956372 | - | 330 | WP_000450409.1 | DUF496 family protein | - |
NR350_RS09705 (1956544) | 1956544..1957602 | - | 1059 | WP_001200891.1 | FUSC family protein | - |
NR350_RS09710 (1957800) | 1957800..1958273 | - | 474 | WP_001105415.1 | DNA gyrase inhibitor SbmC | - |
NR350_RS09715 (1958392) | 1958392..1959558 | - | 1167 | WP_000830156.1 | serine-type D-Ala-D-Ala carboxypeptidase DacD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13898.94 Da Isoelectric Point: 7.8522
>T253546 WP_000854814.1 NZ_CP102379:1954580-1954954 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK
Download Length: 375 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13651.52 Da Isoelectric Point: 5.9541
>AT253546 WP_001285584.1 NZ_CP102379:1954123-1954491 [Escherichia coli]
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCDYVYLAVYPTPEMKN
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCDYVYLAVYPTPEMKN
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829FY50 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 2H28 | |
AlphaFold DB | A0A1M2E8G6 |