Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | chpSB/PRK09812-ChpS |
| Location | 4459083..4459678 | Replicon | chromosome |
| Accession | NZ_CP102378 | ||
| Organism | Escherichia coli strain JB41 | ||
Toxin (Protein)
| Gene name | chpB | Uniprot ID | U9XNP6 |
| Locus tag | NR351_RS21665 | Protein ID | WP_000239577.1 |
| Coordinates | 4459328..4459678 (+) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | chpS | Uniprot ID | U9Y2K1 |
| Locus tag | NR351_RS21660 | Protein ID | WP_001223208.1 |
| Coordinates | 4459083..4459334 (+) | Length | 84 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NR351_RS21650 (4454748) | 4454748..4458527 | + | 3780 | WP_000060911.1 | autotransporter assembly complex protein TamB | - |
| NR351_RS21655 (4458530) | 4458530..4458871 | + | 342 | WP_001219160.1 | gamma-glutamylcyclotransferase | - |
| NR351_RS21660 (4459083) | 4459083..4459334 | + | 252 | WP_001223208.1 | type II toxin-antitoxin system antitoxin ChpS | Antitoxin |
| NR351_RS21665 (4459328) | 4459328..4459678 | + | 351 | WP_000239577.1 | endoribonuclease toxin ChpB | Toxin |
| NR351_RS21670 (4459758) | 4459758..4460288 | - | 531 | WP_000055075.1 | inorganic diphosphatase | - |
| NR351_RS21675 (4460598) | 4460598..4461554 | + | 957 | WP_000265913.1 | galactofuranose ABC transporter substrate-binding protein YtfQ | - |
| NR351_RS21680 (4461694) | 4461694..4463196 | + | 1503 | WP_000205805.1 | sugar ABC transporter ATP-binding protein | - |
| NR351_RS21685 (4463210) | 4463210..4464232 | + | 1023 | WP_001313531.1 | ABC transporter permease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12492.40 Da Isoelectric Point: 5.5572
>T253522 WP_000239577.1 NZ_CP102378:4459328-4459678 [Escherichia coli]
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLHARLAKRIGLAADEVVEEALLRLQAVVE
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLHARLAKRIGLAADEVVEEALLRLQAVVE
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | U9XNP6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9LQ26 |