Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 3051052..3051706 | Replicon | chromosome |
Accession | NZ_CP102378 | ||
Organism | Escherichia coli strain JB41 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | S1EEB2 |
Locus tag | NR351_RS14925 | Protein ID | WP_000244777.1 |
Coordinates | 3051052..3051459 (-) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S1PPB1 |
Locus tag | NR351_RS14930 | Protein ID | WP_000354046.1 |
Coordinates | 3051440..3051706 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NR351_RS14905 (3047009) | 3047009..3048742 | - | 1734 | WP_000813200.1 | single-stranded-DNA-specific exonuclease RecJ | - |
NR351_RS14910 (3048748) | 3048748..3049458 | - | 711 | WP_000715214.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
NR351_RS14915 (3049483) | 3049483..3050379 | - | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
NR351_RS14920 (3050491) | 3050491..3051012 | + | 522 | WP_001055874.1 | flavodoxin FldB | - |
NR351_RS14925 (3051052) | 3051052..3051459 | - | 408 | WP_000244777.1 | protein YgfX | Toxin |
NR351_RS14930 (3051440) | 3051440..3051706 | - | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
NR351_RS14935 (3051949) | 3051949..3052929 | + | 981 | WP_000886062.1 | tRNA-modifying protein YgfZ | - |
NR351_RS14940 (3053125) | 3053125..3053784 | - | 660 | WP_000250274.1 | hemolysin III family protein | - |
NR351_RS14945 (3053948) | 3053948..3054259 | - | 312 | WP_001182957.1 | N(4)-acetylcytidine aminohydrolase | - |
NR351_RS14950 (3054304) | 3054304..3055737 | + | 1434 | WP_001336277.1 | 6-phospho-beta-glucosidase BglA | - |
NR351_RS14955 (3055794) | 3055794..3056537 | - | 744 | WP_000951964.1 | SDR family oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16031.96 Da Isoelectric Point: 11.5202
>T253516 WP_000244777.1 NZ_CP102378:c3051459-3051052 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9LFV7 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 6B58 | |
PDB | 1X6I | |
PDB | 1X6J | |
PDB | 6C12 | |
AlphaFold DB | A0A7U9QD57 |