Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
| Location | 2921392..2921975 | Replicon | chromosome |
| Accession | NZ_CP102378 | ||
| Organism | Escherichia coli strain JB41 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | S1EZP4 |
| Locus tag | NR351_RS14360 | Protein ID | WP_000254738.1 |
| Coordinates | 2921392..2921727 (-) | Length | 112 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | S1P3W5 |
| Locus tag | NR351_RS14365 | Protein ID | WP_000581937.1 |
| Coordinates | 2921727..2921975 (-) | Length | 83 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NR351_RS14345 (2917279) | 2917279..2918577 | - | 1299 | WP_000036723.1 | phosphopyruvate hydratase | - |
| NR351_RS14350 (2918665) | 2918665..2920302 | - | 1638 | WP_000210878.1 | CTP synthase (glutamine hydrolyzing) | - |
| NR351_RS14355 (2920530) | 2920530..2921321 | - | 792 | WP_001071648.1 | nucleoside triphosphate pyrophosphohydrolase | - |
| NR351_RS14360 (2921392) | 2921392..2921727 | - | 336 | WP_000254738.1 | endoribonuclease MazF | Toxin |
| NR351_RS14365 (2921727) | 2921727..2921975 | - | 249 | WP_000581937.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
| NR351_RS14370 (2922053) | 2922053..2924287 | - | 2235 | WP_000226815.1 | GTP pyrophosphokinase | - |
| NR351_RS14375 (2924335) | 2924335..2925636 | - | 1302 | WP_000046812.1 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 12098.04 Da Isoelectric Point: 8.2618
>T253515 WP_000254738.1 NZ_CP102378:c2921727-2921392 [Escherichia coli]
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|