Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yfjZ-ypjF/CbtA-CbeA |
Location | 2787751..2788418 | Replicon | chromosome |
Accession | NZ_CP102378 | ||
Organism | Escherichia coli strain JB41 |
Toxin (Protein)
Gene name | ypjF | Uniprot ID | Q46953 |
Locus tag | NR351_RS13710 | Protein ID | WP_001094400.1 |
Coordinates | 2788089..2788418 (+) | Length | 110 a.a. |
Antitoxin (Protein)
Gene name | yfjZ | Uniprot ID | P52141 |
Locus tag | NR351_RS13705 | Protein ID | WP_000072690.1 |
Coordinates | 2787751..2788068 (+) | Length | 106 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NR351_RS13675 (2782803) | 2782803..2783812 | - | 1010 | Protein_2673 | arsenic transporter | - |
NR351_RS13680 (2783954) | 2783954..2785657 | + | 1704 | WP_000896263.1 | protein YfjW | - |
NR351_RS13685 (2786229) | 2786229..2786452 | + | 224 | Protein_2675 | DUF905 domain-containing protein | - |
NR351_RS13690 (2786555) | 2786555..2787013 | + | 459 | WP_000211841.1 | antirestriction protein | - |
NR351_RS13695 (2787022) | 2787022..2787504 | + | 483 | WP_001407480.1 | RadC family protein | - |
NR351_RS13700 (2787513) | 2787513..2787713 | + | 201 | WP_001395452.1 | DUF987 domain-containing protein | - |
NR351_RS13705 (2787751) | 2787751..2788068 | + | 318 | WP_000072690.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
NR351_RS13710 (2788089) | 2788089..2788418 | + | 330 | WP_001094400.1 | type IV toxin-antitoxin system toxin YpjF | Toxin |
NR351_RS13715 (2788782) | 2788782..2793362 | - | 4581 | WP_010723187.1 | adhesin-like autotransporter YpjA/EhaD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 110 a.a. Molecular weight: 12308.21 Da Isoelectric Point: 7.2761
>T253514 WP_001094400.1 NZ_CP102378:2788089-2788418 [Escherichia coli]
MNTLPATISQAAKPCLSPVAVWQMLLTRLLEQHYGLTLNDTPFSDETVIKEHIDAGITLADAVNFLVEKYELVRIDHRGF
SWQQQSPYISVVDILRARRSTGLLKTNVK
MNTLPATISQAAKPCLSPVAVWQMLLTRLLEQHYGLTLNDTPFSDETVIKEHIDAGITLADAVNFLVEKYELVRIDHRGF
SWQQQSPYISVVDILRARRSTGLLKTNVK
Download Length: 330 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A373F4I3 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | P52141 |