Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 2087748..2088579 | Replicon | chromosome |
| Accession | NZ_CP102378 | ||
| Organism | Escherichia coli strain JB41 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | S1P968 |
| Locus tag | NR351_RS10405 | Protein ID | WP_000854814.1 |
| Coordinates | 2088205..2088579 (+) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | P76364 |
| Locus tag | NR351_RS10400 | Protein ID | WP_001285584.1 |
| Coordinates | 2087748..2088116 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NR351_RS10385 (2085415) | 2085415..2086947 | + | 1533 | WP_001350525.1 | protein YeeR | - |
| NR351_RS10390 (2086944) | 2086944..2087390 | + | 447 | WP_000187523.1 | RadC family protein | - |
| NR351_RS10395 (2087453) | 2087453..2087674 | + | 222 | WP_000692323.1 | DUF987 domain-containing protein | - |
| NR351_RS10400 (2087748) | 2087748..2088116 | + | 369 | WP_001285584.1 | type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA | Antitoxin |
| NR351_RS10405 (2088205) | 2088205..2088579 | + | 375 | WP_000854814.1 | type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA | Toxin |
| NR351_RS10410 (2088576) | 2088576..2088770 | + | 195 | WP_000988600.1 | DUF5983 family protein | - |
| NR351_RS10415 (2088816) | 2088816..2088896 | + | 81 | Protein_2035 | hypothetical protein | - |
| NR351_RS10420 (2089185) | 2089185..2089313 | - | 129 | Protein_2036 | transposase domain-containing protein | - |
| NR351_RS10425 (2089433) | 2089433..2089567 | + | 135 | WP_001297944.1 | EutP/PduV family microcompartment system protein | - |
| NR351_RS10430 (2089668) | 2089668..2089997 | - | 330 | WP_000450409.1 | DUF496 family protein | - |
| NR351_RS10435 (2090169) | 2090169..2091227 | - | 1059 | WP_001200891.1 | FUSC family protein | - |
| NR351_RS10440 (2091425) | 2091425..2091898 | - | 474 | WP_001105415.1 | DNA gyrase inhibitor SbmC | - |
| NR351_RS10445 (2092017) | 2092017..2093183 | - | 1167 | WP_000830156.1 | serine-type D-Ala-D-Ala carboxypeptidase DacD | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13898.94 Da Isoelectric Point: 7.8522
>T253511 WP_000854814.1 NZ_CP102378:2088205-2088579 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK
Download Length: 375 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13651.52 Da Isoelectric Point: 5.9541
>AT253511 WP_001285584.1 NZ_CP102378:2087748-2088116 [Escherichia coli]
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCDYVYLAVYPTPEMKN
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCDYVYLAVYPTPEMKN
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829FY50 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 2H28 | |
| AlphaFold DB | A0A1M2E8G6 |