Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 1655982..1656508 | Replicon | chromosome |
Accession | NZ_CP102378 | ||
Organism | Escherichia coli strain JB41 |
Toxin (Protein)
Gene name | relE | Uniprot ID | S1EXL1 |
Locus tag | NR351_RS08185 | Protein ID | WP_000323025.1 |
Coordinates | 1655982..1656269 (-) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | S1F6D3 |
Locus tag | NR351_RS08190 | Protein ID | WP_000534858.1 |
Coordinates | 1656269..1656508 (-) | Length | 80 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NR351_RS08135 (1651006) | 1651006..1651221 | - | 216 | WP_000839590.1 | phage lysis protein EssD | - |
NR351_RS08140 (1651441) | 1651441..1651611 | + | 171 | WP_211180497.1 | putative zinc-binding protein YnfU | - |
NR351_RS08145 (1651975) | 1651975..1652190 | - | 216 | WP_000066484.1 | cold shock-like protein CspB | - |
NR351_RS08150 (1652491) | 1652491..1652703 | + | 213 | WP_000087756.1 | cold shock-like protein CspF | - |
NR351_RS08155 (1652758) | 1652758..1652847 | + | 90 | WP_120795389.1 | hypothetical protein | - |
NR351_RS08160 (1653125) | 1653125..1653877 | - | 753 | WP_001047135.1 | antitermination protein | - |
NR351_RS08165 (1653891) | 1653891..1654940 | - | 1050 | WP_001393597.1 | DUF968 domain-containing protein | - |
NR351_RS08170 (1654942) | 1654942..1655220 | - | 279 | WP_012304870.1 | hypothetical protein | - |
NR351_RS08175 (1655287) | 1655287..1655538 | - | 252 | WP_000980994.1 | protein Rem | - |
NR351_RS08180 (1655755) | 1655755..1655910 | - | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | - |
NR351_RS08185 (1655982) | 1655982..1656269 | - | 288 | WP_000323025.1 | type II toxin-antitoxin system mRNA interferase RelE | Toxin |
NR351_RS08190 (1656269) | 1656269..1656508 | - | 240 | WP_000534858.1 | type II toxin-antitoxin system antitoxin RelB | Antitoxin |
NR351_RS08195 (1656533) | 1656533..1656838 | + | 306 | WP_001326990.1 | protein YdfV | - |
NR351_RS08200 (1657041) | 1657041..1657373 | + | 333 | WP_001301033.1 | FlxA-like family protein | - |
NR351_RS08205 (1657810) | 1657810..1657959 | - | 150 | WP_011443592.1 | protein YdfW | - |
NR351_RS08210 (1657994) | 1657994..1658272 | - | 279 | Protein_1605 | hypothetical protein | - |
NR351_RS08215 (1658256) | 1658256..1658486 | - | 231 | WP_000920568.1 | dicB transcriptional regulator DicC | - |
NR351_RS08220 (1658570) | 1658570..1658977 | + | 408 | WP_000448564.1 | DNA-binding transcriptional dual regulator DicA | - |
NR351_RS08225 (1659144) | 1659144..1659299 | + | 156 | WP_000379575.1 | DUF1391 family protein | - |
NR351_RS08230 (1659301) | 1659301..1659429 | + | 129 | WP_000344964.1 | protein YdfB | - |
NR351_RS08235 (1659459) | 1659459..1659677 | + | 219 | WP_001171942.1 | protein YdfC | - |
NR351_RS08240 (1660245) | 1660245..1660433 | + | 189 | WP_000854559.1 | cell division inhibition protein DicB | - |
NR351_RS08245 (1660430) | 1660430..1660621 | + | 192 | WP_001083297.1 | lysis protein YdfD | - |
NR351_RS08250 (1660714) | 1660714..1661481 | + | 768 | Protein_1613 | exonuclease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | - | 1634741..1667380 | 32639 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11225.22 Da Isoelectric Point: 10.1967
>T253506 WP_000323025.1 NZ_CP102378:c1656269-1655982 [Escherichia coli]
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|