Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
Location | 1519922..1520560 | Replicon | chromosome |
Accession | NZ_CP102378 | ||
Organism | Escherichia coli strain JB41 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | S1F9G9 |
Locus tag | NR351_RS07505 | Protein ID | WP_000813794.1 |
Coordinates | 1519922..1520098 (+) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | NR351_RS07510 | Protein ID | WP_001270286.1 |
Coordinates | 1520144..1520560 (+) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NR351_RS07485 (1515541) | 1515541..1516755 | - | 1215 | WP_001326689.1 | BenE family transporter YdcO | - |
NR351_RS07490 (1516808) | 1516808..1517344 | + | 537 | WP_000429155.1 | DNA-binding transcriptional regulator SutR | - |
NR351_RS07495 (1517417) | 1517417..1519378 | + | 1962 | WP_001303492.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
NR351_RS07500 (1519470) | 1519470..1519700 | - | 231 | WP_000494244.1 | YncJ family protein | - |
NR351_RS07505 (1519922) | 1519922..1520098 | + | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
NR351_RS07510 (1520144) | 1520144..1520560 | + | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
NR351_RS07515 (1520639) | 1520639..1522045 | + | 1407 | WP_000760626.1 | PLP-dependent aminotransferase family protein | - |
NR351_RS07520 (1522290) | 1522290..1523435 | + | 1146 | WP_000047424.1 | ABC transporter substrate-binding protein | - |
NR351_RS07525 (1523453) | 1523453..1524466 | + | 1014 | WP_000220396.1 | ABC transporter ATP-binding protein | - |
NR351_RS07530 (1524467) | 1524467..1525408 | + | 942 | WP_001251304.1 | ABC transporter permease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T253504 WP_000813794.1 NZ_CP102378:1519922-1520098 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT253504 WP_001270286.1 NZ_CP102378:1520144-1520560 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|