Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 489467..490085 | Replicon | chromosome |
Accession | NZ_CP102378 | ||
Organism | Escherichia coli strain JB41 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | NR351_RS02425 | Protein ID | WP_001291435.1 |
Coordinates | 489467..489685 (-) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | NR351_RS02430 | Protein ID | WP_000344800.1 |
Coordinates | 489711..490085 (-) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NR351_RS02390 (484756) | 484756..485328 | + | 573 | WP_000779842.1 | YbaY family lipoprotein | - |
NR351_RS02395 (485359) | 485359..485670 | - | 312 | WP_000409911.1 | MGMT family protein | - |
NR351_RS02405 (486049) | 486049..486402 | + | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
NR351_RS02410 (486444) | 486444..487994 | - | 1551 | WP_001310610.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
NR351_RS02415 (488158) | 488158..488628 | - | 471 | WP_000136192.1 | YlaC family protein | - |
NR351_RS02420 (488744) | 488744..489295 | - | 552 | WP_000102564.1 | maltose O-acetyltransferase | - |
NR351_RS02425 (489467) | 489467..489685 | - | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
NR351_RS02430 (489711) | 489711..490085 | - | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
NR351_RS02435 (490631) | 490631..493780 | - | 3150 | WP_001132469.1 | efflux RND transporter permease AcrB | - |
NR351_RS02440 (493803) | 493803..494996 | - | 1194 | WP_001295324.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T253494 WP_001291435.1 NZ_CP102378:c489685-489467 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT253494 WP_000344800.1 NZ_CP102378:c490085-489711 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QBQ5 |