Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yafW-ykfI/CbtA-CbeA |
Location | 263328..264007 | Replicon | chromosome |
Accession | NZ_CP102378 | ||
Organism | Escherichia coli strain JB41 |
Toxin (Protein)
Gene name | ykfI | Uniprot ID | P77692 |
Locus tag | NR351_RS01255 | Protein ID | WP_000854672.1 |
Coordinates | 263328..263669 (-) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | yafW | Uniprot ID | Q47684 |
Locus tag | NR351_RS01260 | Protein ID | WP_000070395.1 |
Coordinates | 263690..264007 (-) | Length | 106 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NR351_RS01230 (258677) | 258677..259006 | + | 330 | Protein_238 | sigma factor-binding protein Crl | - |
NR351_RS01235 (259045) | 259045..260100 | - | 1056 | WP_000749863.1 | phosphoporin PhoE | - |
NR351_RS01240 (260388) | 260388..261491 | + | 1104 | WP_001285288.1 | glutamate 5-kinase | - |
NR351_RS01245 (261503) | 261503..262756 | + | 1254 | WP_000893278.1 | glutamate-5-semialdehyde dehydrogenase | - |
NR351_RS01255 (263328) | 263328..263669 | - | 342 | WP_000854672.1 | type IV toxin-antitoxin system toxin YkfI | Toxin |
NR351_RS01260 (263690) | 263690..264007 | - | 318 | WP_000070395.1 | type IV toxin-antitoxin system antitoxin YafW | Antitoxin |
NR351_RS01265 (264026) | 264026..264247 | - | 222 | WP_000691994.1 | DUF987 domain-containing protein | - |
NR351_RS01270 (264256) | 264256..264732 | - | 477 | WP_000811693.1 | RadC family protein | - |
NR351_RS01275 (264748) | 264748..265206 | - | 459 | WP_000211838.1 | antirestriction protein | - |
NR351_RS01280 (265304) | 265304..265543 | - | 240 | WP_000194654.1 | DUF905 family protein | - |
NR351_RS01285 (265620) | 265620..266087 | - | 468 | WP_001547765.1 | protein YkfB | - |
NR351_RS01290 (266110) | 266110..266553 | - | 444 | WP_000824223.1 | lipoprotein YafY | - |
NR351_RS01295 (266553) | 266553..266729 | - | 177 | WP_001285112.1 | hypothetical protein | - |
NR351_RS01300 (266776) | 266776..266967 | - | 192 | Protein_251 | DeoR family transcriptional regulator | - |
NR351_RS01305 (267184) | 267184..268005 | - | 822 | WP_000197389.1 | DUF932 domain-containing protein | - |
NR351_RS01310 (268097) | 268097..268960 | - | 864 | WP_001065553.1 | GTPase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12905.01 Da Isoelectric Point: 9.6543
>T253493 WP_000854672.1 NZ_CP102378:c263669-263328 [Escherichia coli]
MKTLPAITQRAVKPCLSPVAVWQMLLTRLLEQHYGLTINDTPFCNEAVIKEHIDAGITLADAVNFLVEKYELVRIDRKGF
SWQEQSPYLRAADILRARQATGLLRQSRNNVVR
MKTLPAITQRAVKPCLSPVAVWQMLLTRLLEQHYGLTINDTPFCNEAVIKEHIDAGITLADAVNFLVEKYELVRIDRKGF
SWQEQSPYLRAADILRARQATGLLRQSRNNVVR
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|