Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PumAB/COG3657-dnstrm_HI1420 |
Location | 5064064..5064653 | Replicon | chromosome |
Accession | NZ_CP102374 | ||
Organism | Pseudomonas sp. T8 |
Toxin (Protein)
Gene name | PumA | Uniprot ID | - |
Locus tag | NRG23_RS22895 | Protein ID | WP_053270039.1 |
Coordinates | 5064064..5064363 (+) | Length | 100 a.a. |
Antitoxin (Protein)
Gene name | PumB | Uniprot ID | - |
Locus tag | NRG23_RS22900 | Protein ID | WP_028683469.1 |
Coordinates | 5064360..5064653 (+) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NRG23_RS22865 (NRG23_22865) | 5059545..5060432 | - | 888 | WP_038575447.1 | (2E,6E)-farnesyl diphosphate synthase | - |
NRG23_RS22870 (NRG23_22870) | 5060429..5060671 | - | 243 | WP_007924102.1 | exodeoxyribonuclease VII small subunit | - |
NRG23_RS22875 (NRG23_22875) | 5060897..5061988 | + | 1092 | WP_009051081.1 | copper-containing nitrite reductase | - |
NRG23_RS22880 (NRG23_22880) | 5062052..5062351 | + | 300 | WP_009051080.1 | helix-turn-helix transcriptional regulator | - |
NRG23_RS22885 (NRG23_22885) | 5062409..5063419 | + | 1011 | WP_173424526.1 | NAD(P)-dependent alcohol dehydrogenase | - |
NRG23_RS22890 (NRG23_22890) | 5063444..5063893 | - | 450 | WP_009051078.1 | DUF3828 domain-containing protein | - |
NRG23_RS22895 (NRG23_22895) | 5064064..5064363 | + | 300 | WP_053270039.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NRG23_RS22900 (NRG23_22900) | 5064360..5064653 | + | 294 | WP_028683469.1 | putative addiction module antidote protein | Antitoxin |
NRG23_RS22905 (NRG23_22905) | 5064786..5065178 | - | 393 | WP_009051075.1 | hypothetical protein | - |
NRG23_RS22910 (NRG23_22910) | 5065550..5066437 | - | 888 | WP_028683471.1 | LysR family transcriptional regulator | - |
NRG23_RS22915 (NRG23_22915) | 5066564..5067754 | + | 1191 | WP_028683472.1 | serine hydrolase domain-containing protein | - |
NRG23_RS22920 (NRG23_22920) | 5067949..5069112 | + | 1164 | WP_257372261.1 | acyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11267.01 Da Isoelectric Point: 10.4277
>T253489 WP_053270039.1 NZ_CP102374:5064064-5064363 [Pseudomonas sp. T8]
MIEIKQTATFMEWENRLKDSRARALIAARIFRLANGLAGDVPPVGEGVSELRIHYGPGYRVYFQQLGSQLVILLCGGDKS
RQSRDIELAKYLARRWSRS
MIEIKQTATFMEWENRLKDSRARALIAARIFRLANGLAGDVPPVGEGVSELRIHYGPGYRVYFQQLGSQLVILLCGGDKS
RQSRDIELAKYLARRWSRS
Download Length: 300 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|