Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | stbE-relB/ParE-YafN |
Location | 4078581..4079097 | Replicon | chromosome |
Accession | NZ_CP102374 | ||
Organism | Pseudomonas sp. T8 |
Toxin (Protein)
Gene name | stbE | Uniprot ID | - |
Locus tag | NRG23_RS18315 | Protein ID | WP_257371562.1 |
Coordinates | 4078581..4078862 (-) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A554PKE4 |
Locus tag | NRG23_RS18320 | Protein ID | WP_009046356.1 |
Coordinates | 4078852..4079097 (-) | Length | 82 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NRG23_RS18295 (NRG23_18295) | 4074843..4075736 | - | 894 | WP_257371557.1 | HlyD family secretion protein | - |
NRG23_RS18300 (NRG23_18300) | 4075733..4075942 | - | 210 | WP_007932080.1 | DUF1656 domain-containing protein | - |
NRG23_RS18305 (NRG23_18305) | 4075939..4078023 | - | 2085 | WP_257371560.1 | FUSC family protein | - |
NRG23_RS18310 (NRG23_18310) | 4078020..4078448 | - | 429 | WP_028681511.1 | winged helix DNA-binding protein | - |
NRG23_RS18315 (NRG23_18315) | 4078581..4078862 | - | 282 | WP_257371562.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NRG23_RS18320 (NRG23_18320) | 4078852..4079097 | - | 246 | WP_009046356.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
NRG23_RS18325 (NRG23_18325) | 4079162..4079407 | - | 246 | WP_009046355.1 | DUF2789 domain-containing protein | - |
NRG23_RS18330 (NRG23_18330) | 4079538..4079999 | - | 462 | WP_016705004.1 | YbaK/EbsC family protein | - |
NRG23_RS18335 (NRG23_18335) | 4080223..4081608 | + | 1386 | WP_009046353.1 | nodulation protein NfeD | - |
NRG23_RS18340 (NRG23_18340) | 4081610..4082368 | + | 759 | WP_009046352.1 | slipin family protein | - |
NRG23_RS18345 (NRG23_18345) | 4082334..4083329 | - | 996 | WP_257371566.1 | sulfotransferase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10826.76 Da Isoelectric Point: 10.3351
>T253488 WP_257371562.1 NZ_CP102374:c4078862-4078581 [Pseudomonas sp. T8]
MTYKLQFLPSARKEWDKLGHTLREQFKKKLAERLEMPRVPADALHGMADCYKIKLKASGYRLVYQVIEDQVVVSVVAVGK
RECSAVYERARKR
MTYKLQFLPSARKEWDKLGHTLREQFKKKLAERLEMPRVPADALHGMADCYKIKLKASGYRLVYQVIEDQVVVSVVAVGK
RECSAVYERARKR
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|