Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 3970798..3971411 Replicon chromosome
Accession NZ_CP102374
Organism Pseudomonas sp. T8

Toxin (Protein)


Gene name hicA Uniprot ID A0A285EYZ4
Locus tag NRG23_RS17825 Protein ID WP_009041685.1
Coordinates 3971229..3971411 (-) Length 61 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID A0A554PT90
Locus tag NRG23_RS17820 Protein ID WP_009046450.1
Coordinates 3970798..3971199 (-) Length 134 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NRG23_RS17795 (NRG23_17795) 3966347..3967186 + 840 WP_009046455.1 taurine ABC transporter permease TauC -
NRG23_RS17800 (NRG23_17800) 3967413..3968252 + 840 WP_016702562.1 taurine dioxygenase -
NRG23_RS17805 (NRG23_17805) 3968392..3968637 + 246 WP_009046453.1 plasmid stabilization protein -
NRG23_RS17810 (NRG23_17810) 3968634..3969062 + 429 WP_009046452.1 type II toxin-antitoxin system VapC family toxin -
NRG23_RS17815 (NRG23_17815) 3969192..3970229 - 1038 WP_124314665.1 L-glyceraldehyde 3-phosphate reductase -
NRG23_RS17820 (NRG23_17820) 3970798..3971199 - 402 WP_009046450.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
NRG23_RS17825 (NRG23_17825) 3971229..3971411 - 183 WP_009041685.1 type II toxin-antitoxin system HicA family toxin Toxin
NRG23_RS17830 (NRG23_17830) 3971536..3972426 - 891 WP_038630364.1 LysR family transcriptional regulator -
NRG23_RS17835 (NRG23_17835) 3972555..3973295 + 741 WP_009046448.1 SDR family oxidoreductase -
NRG23_RS17840 (NRG23_17840) 3973352..3973840 + 489 WP_028683850.1 DoxX family protein -
NRG23_RS17845 (NRG23_17845) 3973893..3974150 + 258 WP_009046444.1 hypothetical protein -
NRG23_RS17850 (NRG23_17850) 3974263..3976227 - 1965 WP_193384703.1 choline transporter BetT -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(3-59)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(3-127)


Sequences

Toxin        


Download         Length: 61 a.a.        Molecular weight: 6933.08 Da        Isoelectric Point: 10.4588

>T253487 WP_009041685.1 NZ_CP102374:c3971411-3971229 [Pseudomonas sp. T8]
MRSRELIRMIEEDGWYLIAVKGSHHQYKHLHKPGRVTIPHPDADLPRGTIHSILKQAGLK

Download         Length: 183 bp

Antitoxin


Download         Length: 134 a.a.        Molecular weight: 14596.44 Da        Isoelectric Point: 4.9133

>AT253487 WP_009046450.1 NZ_CP102374:c3971199-3970798 [Pseudomonas sp. T8]
MKFPVVLHKDADSGYGVIVPDVPGCFSAGHTAAQAFENVKEALSLHYEGLVADGEPLPQVHEVDVHIDNPDYAGGVWGVI
EFDITPYFGKAVRFNATLPEQLLERIDQTVKRDQRYRSRSGFLAAAALRELSA

Download         Length: 402 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A285EYZ4

Antitoxin

Source ID Structure
AlphaFold DB A0A554PT90

References