Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-StbC |
Location | 3968392..3969062 | Replicon | chromosome |
Accession | NZ_CP102374 | ||
Organism | Pseudomonas sp. T8 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | NRG23_RS17810 | Protein ID | WP_009046452.1 |
Coordinates | 3968634..3969062 (+) | Length | 143 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | A0A3G7DZE9 |
Locus tag | NRG23_RS17805 | Protein ID | WP_009046453.1 |
Coordinates | 3968392..3968637 (+) | Length | 82 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NRG23_RS17785 (NRG23_17785) | 3964483..3965460 | + | 978 | WP_257371482.1 | taurine ABC transporter substrate-binding protein | - |
NRG23_RS17790 (NRG23_17790) | 3965556..3966350 | + | 795 | WP_028683844.1 | taurine ABC transporter ATP-binding subunit | - |
NRG23_RS17795 (NRG23_17795) | 3966347..3967186 | + | 840 | WP_009046455.1 | taurine ABC transporter permease TauC | - |
NRG23_RS17800 (NRG23_17800) | 3967413..3968252 | + | 840 | WP_016702562.1 | taurine dioxygenase | - |
NRG23_RS17805 (NRG23_17805) | 3968392..3968637 | + | 246 | WP_009046453.1 | plasmid stabilization protein | Antitoxin |
NRG23_RS17810 (NRG23_17810) | 3968634..3969062 | + | 429 | WP_009046452.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
NRG23_RS17815 (NRG23_17815) | 3969192..3970229 | - | 1038 | WP_124314665.1 | L-glyceraldehyde 3-phosphate reductase | - |
NRG23_RS17820 (NRG23_17820) | 3970798..3971199 | - | 402 | WP_009046450.1 | type II toxin-antitoxin system HicB family antitoxin | - |
NRG23_RS17825 (NRG23_17825) | 3971229..3971411 | - | 183 | WP_009041685.1 | type II toxin-antitoxin system HicA family toxin | - |
NRG23_RS17830 (NRG23_17830) | 3971536..3972426 | - | 891 | WP_038630364.1 | LysR family transcriptional regulator | - |
NRG23_RS17835 (NRG23_17835) | 3972555..3973295 | + | 741 | WP_009046448.1 | SDR family oxidoreductase | - |
NRG23_RS17840 (NRG23_17840) | 3973352..3973840 | + | 489 | WP_028683850.1 | DoxX family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 143 a.a. Molecular weight: 15867.39 Da Isoelectric Point: 5.4927
>T253486 WP_009046452.1 NZ_CP102374:3968634-3969062 [Pseudomonas sp. T8]
MIVLDTNVLSELMRPQPDTAVLLWIEAQPVEDLYISAMTMAEILHGIARLPHGKRKQTLHASALAMFEEDFIDRIVPFGT
QAALYYAHLVSHRERSGQPINLVDAQIAAICRVHDAAIATRNTKDFTDTGLIVINPWLPLEV
MIVLDTNVLSELMRPQPDTAVLLWIEAQPVEDLYISAMTMAEILHGIARLPHGKRKQTLHASALAMFEEDFIDRIVPFGT
QAALYYAHLVSHRERSGQPINLVDAQIAAICRVHDAAIATRNTKDFTDTGLIVINPWLPLEV
Download Length: 429 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|