Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RHH(antitoxin) |
Location | 2750799..2751327 | Replicon | chromosome |
Accession | NZ_CP102374 | ||
Organism | Pseudomonas sp. T8 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A7S5LMJ4 |
Locus tag | NRG23_RS12255 | Protein ID | WP_038581545.1 |
Coordinates | 2751028..2751327 (+) | Length | 100 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A7S5HLJ1 |
Locus tag | NRG23_RS12250 | Protein ID | WP_038581543.1 |
Coordinates | 2750799..2751038 (+) | Length | 80 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NRG23_RS12220 (NRG23_12220) | 2746063..2746218 | - | 156 | Protein_2422 | restriction endonuclease | - |
NRG23_RS12225 (NRG23_12225) | 2746381..2747271 | + | 891 | WP_257374667.1 | phosphotransferase | - |
NRG23_RS12230 (NRG23_12230) | 2747365..2747889 | - | 525 | WP_009047451.1 | DUF4142 domain-containing protein | - |
NRG23_RS12235 (NRG23_12235) | 2748028..2749368 | - | 1341 | WP_009047450.1 | sensor domain-containing diguanylate cyclase | - |
NRG23_RS12240 (NRG23_12240) | 2749480..2750118 | - | 639 | WP_016702101.1 | LysE family translocator | - |
NRG23_RS12245 (NRG23_12245) | 2750246..2750662 | - | 417 | WP_009047448.1 | fosfomycin resistance glutathione transferase | - |
NRG23_RS12250 (NRG23_12250) | 2750799..2751038 | + | 240 | WP_038581543.1 | ribbon-helix-helix protein, CopG family | Antitoxin |
NRG23_RS12255 (NRG23_12255) | 2751028..2751327 | + | 300 | WP_038581545.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NRG23_RS12260 (NRG23_12260) | 2751387..2752535 | - | 1149 | WP_110177469.1 | L-threonine dehydrogenase | - |
NRG23_RS12265 (NRG23_12265) | 2752693..2753712 | + | 1020 | WP_009047445.1 | DUF4917 family protein | - |
NRG23_RS12270 (NRG23_12270) | 2753931..2754473 | - | 543 | WP_007922237.1 | XRE family transcriptional regulator | - |
NRG23_RS12275 (NRG23_12275) | 2754633..2755415 | + | 783 | WP_041988770.1 | aldolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11487.13 Da Isoelectric Point: 10.8916
>T253484 WP_038581545.1 NZ_CP102374:2751028-2751327 [Pseudomonas sp. T8]
MHVEWLRSALKNLDDEAAYIAQDSPQAAAEFVKAILSSIQHLSRFPASGREGRLPGTREWVVPNRPYLIPYRVRQGRLQI
LRIFHTRRLPPAGWQDDRQ
MHVEWLRSALKNLDDEAAYIAQDSPQAAAEFVKAILSSIQHLSRFPASGREGRLPGTREWVVPNRPYLIPYRVRQGRLQI
LRIFHTRRLPPAGWQDDRQ
Download Length: 300 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7S5LMJ4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7S5HLJ1 |