Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | PumAB/upstrm_HI1419-dnstrm_HI1420 |
| Location | 1866996..1867581 | Replicon | chromosome |
| Accession | NZ_CP102374 | ||
| Organism | Pseudomonas sp. T8 | ||
Toxin (Protein)
| Gene name | PumA | Uniprot ID | A0A7S5HMS4 |
| Locus tag | NRG23_RS08140 | Protein ID | WP_016705075.1 |
| Coordinates | 1866996..1867289 (+) | Length | 98 a.a. |
Antitoxin (Protein)
| Gene name | PumB | Uniprot ID | - |
| Locus tag | NRG23_RS08145 | Protein ID | WP_150085183.1 |
| Coordinates | 1867291..1867581 (+) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NRG23_RS08125 (NRG23_08125) | 1862640..1863884 | - | 1245 | WP_028682913.1 | M20/M25/M40 family metallo-hydrolase | - |
| NRG23_RS08130 (NRG23_08130) | 1863978..1865102 | - | 1125 | WP_257374333.1 | diguanylate cyclase | - |
| NRG23_RS08135 (NRG23_08135) | 1865367..1866761 | + | 1395 | WP_257374334.1 | VOC family protein | - |
| NRG23_RS08140 (NRG23_08140) | 1866996..1867289 | + | 294 | WP_016705075.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NRG23_RS08145 (NRG23_08145) | 1867291..1867581 | + | 291 | WP_150085183.1 | putative addiction module antidote protein | Antitoxin |
| NRG23_RS08150 (NRG23_08150) | 1867981..1868568 | - | 588 | WP_009048176.1 | hypothetical protein | - |
| NRG23_RS08155 (NRG23_08155) | 1868687..1870069 | - | 1383 | WP_257374335.1 | efflux transporter outer membrane subunit | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 98 a.a. Molecular weight: 10699.27 Da Isoelectric Point: 10.0959
>T253482 WP_016705075.1 NZ_CP102374:1866996-1867289 [Pseudomonas sp. T8]
MDYEILQTTVFAQWHTTLRDLRARIAIARRIERASAGNLGDVKNLGGGLSEMRVNTGAGYRLYFTVRGNTLIVLLLGGDK
SSQPADICQARSLAKEF
MDYEILQTTVFAQWHTTLRDLRARIAIARRIERASAGNLGDVKNLGGGLSEMRVNTGAGYRLYFTVRGNTLIVLLLGGDK
SSQPADICQARSLAKEF
Download Length: 294 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|