Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VapB |
| Location | 4215583..4216211 | Replicon | chromosome |
| Accession | NZ_CP102359 | ||
| Organism | Streptomyces sp. B146 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | M6G09_RS18445 | Protein ID | WP_243780232.1 |
| Coordinates | 4215801..4216211 (+) | Length | 137 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | M6G09_RS18440 | Protein ID | WP_031046014.1 |
| Coordinates | 4215583..4215804 (+) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M6G09_RS18415 (M6G09_18455) | 4210933..4211148 | - | 216 | WP_224299939.1 | hypothetical protein | - |
| M6G09_RS18420 (M6G09_18460) | 4211664..4212473 | + | 810 | WP_277725443.1 | peptidoglycan-binding protein | - |
| M6G09_RS18425 (M6G09_18465) | 4212470..4213366 | + | 897 | WP_277725444.1 | XRE family transcriptional regulator | - |
| M6G09_RS18430 (M6G09_18470) | 4213413..4214552 | - | 1140 | WP_277725445.1 | NAD(P)/FAD-dependent oxidoreductase | - |
| M6G09_RS18435 (M6G09_18475) | 4214715..4215407 | - | 693 | WP_194276764.1 | TetR/AcrR family transcriptional regulator C-terminal domain-containing protein | - |
| M6G09_RS18440 (M6G09_18480) | 4215583..4215804 | + | 222 | WP_031046014.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| M6G09_RS18445 (M6G09_18485) | 4215801..4216211 | + | 411 | WP_243780232.1 | PIN domain-containing protein | Toxin |
| M6G09_RS18455 (M6G09_18495) | 4217156..4217731 | + | 576 | WP_031043809.1 | dCTP deaminase | - |
| M6G09_RS18460 (M6G09_18500) | 4217757..4218266 | + | 510 | WP_277725446.1 | phosphoribosyltransferase | - |
| M6G09_RS18465 (M6G09_18505) | 4218425..4218556 | + | 132 | WP_263446916.1 | hypothetical protein | - |
| M6G09_RS18470 (M6G09_18510) | 4219001..4219123 | - | 123 | Protein_3631 | NUDIX hydrolase | - |
| M6G09_RS18475 (M6G09_18515) | 4219121..4219711 | + | 591 | Protein_3632 | replication initiation protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 14957.58 Da Isoelectric Point: 5.4153
>T253479 WP_243780232.1 NZ_CP102359:4215801-4216211 [Streptomyces sp. B146]
VMYLLDTSGLVRLLRDANLQSAWHDAIDAGAIASCYVQRTEFLYSARNRSEYDEIAEMFSDLYPDAAVPKNAGRWISAVQ
HRMAQAGEHRSASAVDLVIAATAAHHGLTVLHDDADYGTVARHASDLNEHNVHEVV
VMYLLDTSGLVRLLRDANLQSAWHDAIDAGAIASCYVQRTEFLYSARNRSEYDEIAEMFSDLYPDAAVPKNAGRWISAVQ
HRMAQAGEHRSASAVDLVIAATAAHHGLTVLHDDADYGTVARHASDLNEHNVHEVV
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|