Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 5918263..5918788 | Replicon | chromosome |
| Accession | NZ_CP102358 | ||
| Organism | Pseudomonas zeae strain BIM B-582 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | A0A7H8GF58 |
| Locus tag | NQ186_RS26345 | Protein ID | WP_016984129.1 |
| Coordinates | 5918492..5918788 (+) | Length | 99 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | A0A4R7UU95 |
| Locus tag | NQ186_RS26340 | Protein ID | WP_016984130.1 |
| Coordinates | 5918263..5918502 (+) | Length | 80 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NQ186_RS26315 (NQ186_26315) | 5914063..5914524 | + | 462 | WP_007910890.1 | GNAT family N-acetyltransferase | - |
| NQ186_RS26320 (NQ186_26320) | 5914755..5915405 | + | 651 | WP_064118832.1 | DedA family protein | - |
| NQ186_RS26325 (NQ186_26325) | 5915410..5916222 | + | 813 | WP_257356263.1 | zinc-dependent peptidase | - |
| NQ186_RS26330 (NQ186_26330) | 5916335..5916862 | + | 528 | WP_003205933.1 | inorganic diphosphatase | - |
| NQ186_RS26335 (NQ186_26335) | 5917086..5917832 | + | 747 | WP_093434520.1 | helix-turn-helix transcriptional regulator | - |
| NQ186_RS26340 (NQ186_26340) | 5918263..5918502 | + | 240 | WP_016984130.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| NQ186_RS26345 (NQ186_26345) | 5918492..5918788 | + | 297 | WP_016984129.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NQ186_RS26350 (NQ186_26350) | 5918843..5919655 | - | 813 | WP_257356266.1 | DUF2135 domain-containing protein | - |
| NQ186_RS26355 (NQ186_26355) | 5919659..5921278 | - | 1620 | WP_257356269.1 | DUF2300 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11651.55 Da Isoelectric Point: 9.6908
>T253477 WP_016984129.1 NZ_CP102358:5918492-5918788 [Pseudomonas zeae]
MTYNLEFDRRALKEWNKLGDTVRHQFKKKLTEVLENPRIEANRLRELPDCYKVKLKSAGYRLIYQVLDQEIVVFVIAIGK
REREAAYEVAQDRLSLLP
MTYNLEFDRRALKEWNKLGDTVRHQFKKKLTEVLENPRIEANRLRELPDCYKVKLKSAGYRLIYQVLDQEIVVFVIAIGK
REREAAYEVAQDRLSLLP
Download Length: 297 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7H8GF58 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A4R7UU95 |