Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 2063143..2063759 | Replicon | chromosome |
| Accession | NZ_CP102358 | ||
| Organism | Pseudomonas zeae strain BIM B-582 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | - |
| Locus tag | NQ186_RS09160 | Protein ID | WP_095050205.1 |
| Coordinates | 2063143..2063355 (+) | Length | 71 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | NQ186_RS09165 | Protein ID | WP_099758378.1 |
| Coordinates | 2063355..2063759 (+) | Length | 135 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NQ186_RS09135 (NQ186_09135) | 2058318..2060306 | + | 1989 | WP_093439827.1 | heme lyase CcmF/NrfE family subunit | - |
| NQ186_RS09140 (NQ186_09140) | 2060303..2060839 | + | 537 | WP_166222385.1 | DsbE family thiol:disulfide interchange protein | - |
| NQ186_RS09145 (NQ186_09145) | 2060836..2061306 | + | 471 | WP_093439835.1 | cytochrome c-type biogenesis protein CcmH | - |
| NQ186_RS09150 (NQ186_09150) | 2061303..2062505 | + | 1203 | WP_093439839.1 | c-type cytochrome biogenesis protein CcmI | - |
| NQ186_RS09155 (NQ186_09155) | 2062531..2062935 | + | 405 | WP_093439844.1 | hypothetical protein | - |
| NQ186_RS09160 (NQ186_09160) | 2063143..2063355 | + | 213 | WP_095050205.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| NQ186_RS09165 (NQ186_09165) | 2063355..2063759 | + | 405 | WP_099758378.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| NQ186_RS09170 (NQ186_09170) | 2063829..2065016 | - | 1188 | WP_116256524.1 | MFS transporter | - |
| NQ186_RS09175 (NQ186_09175) | 2065260..2065880 | + | 621 | WP_116256523.1 | DUF5666 domain-containing protein | - |
| NQ186_RS09180 (NQ186_09180) | 2066120..2067118 | - | 999 | WP_116256522.1 | sulfate ABC transporter substrate-binding protein | - |
| NQ186_RS09185 (NQ186_09185) | 2067223..2068047 | - | 825 | WP_257357708.1 | ion transporter | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 71 a.a. Molecular weight: 8044.22 Da Isoelectric Point: 10.3456
>T253474 WP_095050205.1 NZ_CP102358:2063143-2063355 [Pseudomonas zeae]
VQSRLLIKELEEAGWTLDRITGSHHIFRHRYNPYTIPVPHPKKDLPLGTVKSIRRRAGLYNPPASFEGDP
VQSRLLIKELEEAGWTLDRITGSHHIFRHRYNPYTIPVPHPKKDLPLGTVKSIRRRAGLYNPPASFEGDP
Download Length: 213 bp
Antitoxin
Download Length: 135 a.a. Molecular weight: 14775.68 Da Isoelectric Point: 4.2870
>AT253474 WP_099758378.1 NZ_CP102358:2063355-2063759 [Pseudomonas zeae]
MQYPICIEWGDENTAIGIQIPDIPGAVTAGDSFEDAYNAAVEVAHIMLQEIAADGESIPMPTSASAHRSNPDFADMGWGM
LELDISPYLGKTEKVNVTLPGYVIQRIDRYVREHNVKSRSSFLADAAMEKLVRY
MQYPICIEWGDENTAIGIQIPDIPGAVTAGDSFEDAYNAAVEVAHIMLQEIAADGESIPMPTSASAHRSNPDFADMGWGM
LELDISPYLGKTEKVNVTLPGYVIQRIDRYVREHNVKSRSSFLADAAMEKLVRY
Download Length: 405 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|