Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/upstrm_HI1419-dnstrm_HI1420 |
| Location | 946498..947094 | Replicon | chromosome |
| Accession | NZ_CP102358 | ||
| Organism | Pseudomonas zeae strain BIM B-582 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | NQ186_RS04080 | Protein ID | WP_093430233.1 |
| Coordinates | 946792..947094 (-) | Length | 101 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | NQ186_RS04075 | Protein ID | WP_093430232.1 |
| Coordinates | 946498..946788 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NQ186_RS04055 (NQ186_04055) | 942800..944920 | - | 2121 | WP_257356926.1 | TonB-dependent copper receptor | - |
| NQ186_RS04060 (NQ186_04060) | 945006..945452 | - | 447 | WP_257356927.1 | DUF2946 domain-containing protein | - |
| NQ186_RS04065 (NQ186_04065) | 945474..945953 | - | 480 | WP_093430230.1 | copper chaperone PCu(A)C | - |
| NQ186_RS04070 (NQ186_04070) | 946002..946400 | - | 399 | WP_122599673.1 | DUF2946 domain-containing protein | - |
| NQ186_RS04075 (NQ186_04075) | 946498..946788 | - | 291 | WP_093430232.1 | putative addiction module antidote protein | Antitoxin |
| NQ186_RS04080 (NQ186_04080) | 946792..947094 | - | 303 | WP_093430233.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NQ186_RS04085 (NQ186_04085) | 947266..947982 | - | 717 | WP_257356928.1 | cobalt-precorrin-6A reductase | - |
| NQ186_RS04090 (NQ186_04090) | 947979..949076 | - | 1098 | WP_099757880.1 | cobalt-precorrin-5B (C(1))-methyltransferase | - |
| NQ186_RS04095 (NQ186_04095) | 949069..950280 | - | 1212 | WP_257356929.1 | precorrin-6y C5,15-methyltransferase (decarboxylating) subunit CbiE | - |
| NQ186_RS04100 (NQ186_04100) | 950323..951708 | + | 1386 | WP_093430237.1 | precorrin-3B synthase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11518.24 Da Isoelectric Point: 9.7107
>T253473 WP_093430233.1 NZ_CP102358:c947094-946792 [Pseudomonas zeae]
MIAFERSRIFSEWLDSLKDIKGKGRIISRIKTAEHGNFGDCGFVGDTVYEMRVHYGPGYRMYFTRKGEVIYLLLIGGDKS
TQKRDIKRAVQMAHNIGNEE
MIAFERSRIFSEWLDSLKDIKGKGRIISRIKTAEHGNFGDCGFVGDTVYEMRVHYGPGYRMYFTRKGEVIYLLLIGGDKS
TQKRDIKRAVQMAHNIGNEE
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|