Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicB(antitoxin) |
Location | 564917..565556 | Replicon | chromosome |
Accession | NZ_CP102358 | ||
Organism | Pseudomonas zeae strain BIM B-582 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | - |
Locus tag | NQ186_RS02500 | Protein ID | WP_095190108.1 |
Coordinates | 564917..565099 (+) | Length | 61 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | NQ186_RS02505 | Protein ID | WP_257356808.1 |
Coordinates | 565131..565556 (+) | Length | 142 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NQ186_RS02465 (NQ186_02465) | 560127..560504 | + | 378 | WP_008080517.1 | GNAT family N-acetyltransferase | - |
NQ186_RS02470 (NQ186_02470) | 560501..561217 | + | 717 | WP_099757732.1 | AzlC family ABC transporter permease | - |
NQ186_RS02475 (NQ186_02475) | 561196..561513 | + | 318 | WP_007909127.1 | AzlD domain-containing protein | - |
NQ186_RS02480 (NQ186_02480) | 561430..562356 | - | 927 | WP_093430009.1 | LysR family transcriptional regulator | - |
NQ186_RS02485 (NQ186_02485) | 563054..563461 | + | 408 | WP_093430011.1 | MbcA/ParS/Xre antitoxin family protein | - |
NQ186_RS02490 (NQ186_02490) | 563473..564138 | + | 666 | WP_257356805.1 | RES family NAD+ phosphorylase | - |
NQ186_RS02495 (NQ186_02495) | 564181..564462 | - | 282 | WP_122844308.1 | DUF3077 domain-containing protein | - |
NQ186_RS02500 (NQ186_02500) | 564917..565099 | + | 183 | WP_095190108.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
NQ186_RS02505 (NQ186_02505) | 565131..565556 | + | 426 | WP_257356808.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
NQ186_RS02510 (NQ186_02510) | 566162..567406 | + | 1245 | WP_212626030.1 | hypothetical protein | - |
NQ186_RS02515 (NQ186_02515) | 567399..568148 | + | 750 | WP_169880155.1 | hypothetical protein | - |
NQ186_RS02520 (NQ186_02520) | 568120..570447 | + | 2328 | WP_257356810.1 | AAA family ATPase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6795.85 Da Isoelectric Point: 10.7304
>T253472 WP_095190108.1 NZ_CP102358:564917-565099 [Pseudomonas zeae]
MKYSEFRRWLKAQGVEFQNGKGSHFKVSLNGKSTVFPDHGAKEMGEGLRKSIIKQLGLKD
MKYSEFRRWLKAQGVEFQNGKGSHFKVSLNGKSTVFPDHGAKEMGEGLRKSIIKQLGLKD
Download Length: 183 bp
Antitoxin
Download Length: 142 a.a. Molecular weight: 15595.75 Da Isoelectric Point: 4.5890
>AT253472 WP_257356808.1 NZ_CP102358:565131-565556 [Pseudomonas zeae]
MFEYALEVHEEPDSVWLSCAEIPEMHAVGDTLEQALDSAIDAIETALSIYVDDRRLAPTGQAGEQKSDVVLRLPALTAAK
VALWNTLLESGVSKAELARRLGVQRPQVDRLVDFLHHSKIENVERALQQLGRRILLSVEAA
MFEYALEVHEEPDSVWLSCAEIPEMHAVGDTLEQALDSAIDAIETALSIYVDDRRLAPTGQAGEQKSDVVLRLPALTAAK
VALWNTLLESGVSKAELARRLGVQRPQVDRLVDFLHHSKIENVERALQQLGRRILLSVEAA
Download Length: 426 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|