Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicA-HicB |
Location | 503007..503650 | Replicon | chromosome |
Accession | NZ_CP102358 | ||
Organism | Pseudomonas zeae strain BIM B-582 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | A0A4R7VCK5 |
Locus tag | NQ186_RS02200 | Protein ID | WP_026000492.1 |
Coordinates | 503007..503189 (+) | Length | 61 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | NQ186_RS02205 | Protein ID | WP_257356775.1 |
Coordinates | 503249..503650 (+) | Length | 134 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NQ186_RS02185 (NQ186_02185) | 499016..499942 | + | 927 | WP_016983653.1 | serine acetyltransferase | - |
NQ186_RS02190 (NQ186_02190) | 500394..502355 | + | 1962 | WP_163030199.1 | choline transporter BetT | - |
NQ186_RS02195 (NQ186_02195) | 502381..502641 | - | 261 | WP_007949845.1 | hypothetical protein | - |
NQ186_RS02200 (NQ186_02200) | 503007..503189 | + | 183 | WP_026000492.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
NQ186_RS02205 (NQ186_02205) | 503249..503650 | + | 402 | WP_257356775.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
NQ186_RS02210 (NQ186_02210) | 503656..504693 | - | 1038 | WP_257356777.1 | LacI family DNA-binding transcriptional regulator | - |
NQ186_RS02215 (NQ186_02215) | 504899..507124 | + | 2226 | WP_257356778.1 | TonB-dependent receptor | - |
NQ186_RS02220 (NQ186_02220) | 507126..508445 | + | 1320 | WP_257356779.1 | LLM class flavin-dependent oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6903.02 Da Isoelectric Point: 10.5417
>T253471 WP_026000492.1 NZ_CP102358:503007-503189 [Pseudomonas zeae]
MRSREMIRMIEDDGWYLVAVKGSHHQYKHPHKPGRVTIKHPDSDLPKGTINSILKQAGLK
MRSREMIRMIEDDGWYLVAVKGSHHQYKHPHKPGRVTIKHPDSDLPKGTINSILKQAGLK
Download Length: 183 bp
Antitoxin
Download Length: 134 a.a. Molecular weight: 14723.53 Da Isoelectric Point: 4.4631
>AT253471 WP_257356775.1 NZ_CP102358:503249-503650 [Pseudomonas zeae]
MKFPVVLHKDVDSDYGVIIPDVPGCFSAGTTVAEAFENTQEALALHYEGLVADNAPLPQVRDIDAHLDNPDYAGGIWGVV
DFDITPYFGKSVRFNATLPEQLLERIDQTVRRDQRYRSRSGFLAAAALRELSV
MKFPVVLHKDVDSDYGVIIPDVPGCFSAGTTVAEAFENTQEALALHYEGLVADNAPLPQVRDIDAHLDNPDYAGGIWGVV
DFDITPYFGKSVRFNATLPEQLLERIDQTVRRDQRYRSRSGFLAAAALRELSV
Download Length: 402 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|