Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicA-HicB |
Location | 1408688..1409316 | Replicon | chromosome |
Accession | NZ_CP102355 | ||
Organism | Paracoccus sp. SMMA_5_TC |
Toxin (Protein)
Gene name | hicA | Uniprot ID | - |
Locus tag | GB880_RS07135 | Protein ID | WP_154492180.1 |
Coordinates | 1409128..1409316 (-) | Length | 63 a.a. |
Antitoxin (Protein)
Gene name | hicA | Uniprot ID | - |
Locus tag | GB880_RS07130 | Protein ID | WP_154492182.1 |
Coordinates | 1408688..1409083 (-) | Length | 132 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
GB880_RS07105 (GB880_007105) | 1404127..1404375 | + | 249 | WP_154492192.1 | phage tail assembly protein | - |
GB880_RS07110 (GB880_007110) | 1404493..1406967 | + | 2475 | WP_263467001.1 | phage tail tape measure protein | - |
GB880_RS07115 (GB880_007115) | 1406967..1407383 | + | 417 | WP_154492188.1 | phage tail protein | - |
GB880_RS07120 (GB880_007120) | 1407346..1407567 | + | 222 | WP_154492186.1 | tail protein X | - |
GB880_RS07125 (GB880_007125) | 1407597..1408583 | + | 987 | WP_154492184.1 | contractile injection system protein, VgrG/Pvc8 family | - |
GB880_RS07130 (GB880_007130) | 1408688..1409083 | - | 396 | WP_154492182.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
GB880_RS07135 (GB880_007135) | 1409128..1409316 | - | 189 | WP_154492180.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
GB880_RS07140 (GB880_007140) | 1409940..1410146 | - | 207 | WP_154492177.1 | hypothetical protein | - |
GB880_RS07145 (GB880_007145) | 1410309..1411565 | + | 1257 | WP_154492174.1 | aspartate kinase | - |
GB880_RS07150 (GB880_007150) | 1411597..1413846 | + | 2250 | WP_154492171.1 | phosphoenolpyruvate--protein phosphotransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 63 a.a. Molecular weight: 7019.24 Da Isoelectric Point: 11.3427
>T253470 WP_154492180.1 NZ_CP102355:c1409316-1409128 [Paracoccus sp. SMMA_5_TC]
MQIERNSRQILQVLKAAGFEEVSKRGSHLKLRKGERTVIVPHPKKDLPLGTARNIYQQAGLL
MQIERNSRQILQVLKAAGFEEVSKRGSHLKLRKGERTVIVPHPKKDLPLGTARNIYQQAGLL
Download Length: 189 bp
Antitoxin
Download Length: 132 a.a. Molecular weight: 14013.90 Da Isoelectric Point: 4.5486
>AT253470 WP_154492182.1 NZ_CP102355:c1409083-1408688 [Paracoccus sp. SMMA_5_TC]
MKQYSAIIHHDPGAAFGLTFPDLPGCFAAADCWDDVPKAASEALNLWFEDQPEVPPSPLDALLKRQDVAQALAEGATLIT
IPYIPADGTLERVNISIERGLLRAVDAAAKERGMTRSSFLASAARHELTGA
MKQYSAIIHHDPGAAFGLTFPDLPGCFAAADCWDDVPKAASEALNLWFEDQPEVPPSPLDALLKRQDVAQALAEGATLIT
IPYIPADGTLERVNISIERGLLRAVDAAAKERGMTRSSFLASAARHELTGA
Download Length: 396 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|