Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 1375819..1376427 Replicon chromosome
Accession NZ_CP102355
Organism Paracoccus sp. SMMA_5_TC

Toxin (Protein)


Gene name hicA Uniprot ID A0A7X2NZ63
Locus tag GB880_RS06920 Protein ID WP_028716902.1
Coordinates 1376239..1376427 (-) Length 63 a.a.

Antitoxin (Protein)


Gene name hicA Uniprot ID A0A7X2NZI5
Locus tag GB880_RS06915 Protein ID WP_028716903.1
Coordinates 1375819..1376226 (-) Length 136 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
GB880_RS06865 (GB880_006865) 1370905..1371315 - 411 WP_263466989.1 hypothetical protein -
GB880_RS06870 (GB880_006870) 1371317..1371631 - 315 WP_154494122.1 hypothetical protein -
GB880_RS06875 (GB880_006875) 1371765..1371935 - 171 WP_154494121.1 hypothetical protein -
GB880_RS06880 (GB880_006880) 1371985..1372371 - 387 WP_154494120.1 hypothetical protein -
GB880_RS06885 (GB880_006885) 1372368..1372634 - 267 WP_154494119.1 hypothetical protein -
GB880_RS06890 (GB880_006890) 1372980..1373306 - 327 WP_154494118.1 hypothetical protein -
GB880_RS06895 (GB880_006895) 1373584..1374249 - 666 WP_154494117.1 S24 family peptidase -
GB880_RS06900 (GB880_006900) 1374334..1374549 + 216 WP_154494116.1 hypothetical protein -
GB880_RS06905 (GB880_006905) 1374630..1374899 + 270 WP_028716904.1 hypothetical protein -
GB880_RS06910 (GB880_006910) 1375572..1375832 - 261 WP_154494115.1 hypothetical protein -
GB880_RS06915 (GB880_006915) 1375819..1376226 - 408 WP_028716903.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
GB880_RS06920 (GB880_006920) 1376239..1376427 - 189 WP_028716902.1 type II toxin-antitoxin system HicA family toxin Toxin
GB880_RS06925 (GB880_006925) 1376608..1376838 - 231 WP_154494114.1 hypothetical protein -
GB880_RS06930 (GB880_006930) 1377051..1377929 + 879 WP_154494113.1 hypothetical protein -
GB880_RS06935 (GB880_006935) 1377936..1378946 + 1011 WP_154494112.1 helix-turn-helix domain-containing protein -
GB880_RS06940 (GB880_006940) 1378943..1379299 + 357 WP_154494111.1 hypothetical protein -
GB880_RS06945 (GB880_006945) 1379437..1379667 + 231 WP_154494110.1 hypothetical protein -
GB880_RS06950 (GB880_006950) 1379676..1380080 + 405 WP_195840834.1 VRR-NUC domain-containing protein -
GB880_RS06955 (GB880_006955) 1380077..1380769 + 693 WP_154494108.1 hypothetical protein -
GB880_RS06960 (GB880_006960) 1380774..1381379 + 606 WP_154494107.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(5-61)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(3-127)


Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7264.47 Da        Isoelectric Point: 11.1468

>T253469 WP_028716902.1 NZ_CP102355:c1376427-1376239 [Paracoccus sp. SMMA_5_TC]
MERNSRKLIKMLEADGWVRVAVKGDHWQFKHPEKPGRVTVPHPNKDIKPGTVMSIYRQAGWR

Download         Length: 189 bp

Antitoxin


Download         Length: 136 a.a.        Molecular weight: 14416.13 Da        Isoelectric Point: 4.6144

>AT253469 WP_028716903.1 NZ_CP102355:c1376226-1375819 [Paracoccus sp. SMMA_5_TC]
MRYVAFLHTDEAGGFGISFPDFPGAISDGDTVEQAIQRGEQALAFHVQGMREDGLDVPAPRSVDDILADPALAEWREGAQ
IAHVALILDRGSPKRVNISLDPGLLDAIDAEAARRGMTRSAFLSSAARAEIHAAH

Download         Length: 408 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7X2NZ63

Antitoxin

Source ID Structure
AlphaFold DB A0A7X2NZI5

References