Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 1408817..1409445 | Replicon | chromosome |
| Accession | NZ_CP102352 | ||
| Organism | Paracoccus sp. SMMA_5 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | - |
| Locus tag | GB879_RS07145 | Protein ID | WP_154492180.1 |
| Coordinates | 1409257..1409445 (-) | Length | 63 a.a. |
Antitoxin (Protein)
| Gene name | hicA | Uniprot ID | - |
| Locus tag | GB879_RS07140 | Protein ID | WP_263475362.1 |
| Coordinates | 1408817..1409260 (-) | Length | 148 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| GB879_RS07115 (GB879_007115) | 1404256..1404504 | + | 249 | WP_154492192.1 | phage tail assembly protein | - |
| GB879_RS07120 (GB879_007120) | 1404622..1407096 | + | 2475 | WP_263467001.1 | phage tail tape measure protein | - |
| GB879_RS07125 (GB879_007125) | 1407096..1407512 | + | 417 | WP_154492188.1 | phage tail protein | - |
| GB879_RS07130 (GB879_007130) | 1407475..1407696 | + | 222 | WP_154492186.1 | tail protein X | - |
| GB879_RS07135 (GB879_007135) | 1407687..1408712 | + | 1026 | WP_195841233.1 | contractile injection system protein, VgrG/Pvc8 family | - |
| GB879_RS07140 (GB879_007140) | 1408817..1409260 | - | 444 | WP_263475362.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| GB879_RS07145 (GB879_007145) | 1409257..1409445 | - | 189 | WP_154492180.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| GB879_RS07150 (GB879_007150) | 1410069..1410275 | - | 207 | WP_154492177.1 | hypothetical protein | - |
| GB879_RS07155 (GB879_007155) | 1410438..1411694 | + | 1257 | WP_154492174.1 | aspartate kinase | - |
| GB879_RS07160 (GB879_007160) | 1411726..1413975 | + | 2250 | WP_154492171.1 | phosphoenolpyruvate--protein phosphotransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 63 a.a. Molecular weight: 7019.24 Da Isoelectric Point: 11.3427
>T253468 WP_154492180.1 NZ_CP102352:c1409445-1409257 [Paracoccus sp. SMMA_5]
MQIERNSRQILQVLKAAGFEEVSKRGSHLKLRKGERTVIVPHPKKDLPLGTARNIYQQAGLL
MQIERNSRQILQVLKAAGFEEVSKRGSHLKLRKGERTVIVPHPKKDLPLGTARNIYQQAGLL
Download Length: 189 bp
Antitoxin
Download Length: 148 a.a. Molecular weight: 15630.73 Da Isoelectric Point: 4.4915
>AT253468 WP_263475362.1 NZ_CP102352:c1409260-1408817 [Paracoccus sp. SMMA_5]
VSPAHLILATNAEGELMKQYSAIIHHDPGAAFGLTFPDLPGCFAAADCWDDVPKAASEALNLWFEDQPEVPPSPLDALLK
RQDVAQALAEGATLITIPYIPADGTLERVNISIERGLLRAVDAAAKERGMTRSSFLASAARHELTGA
VSPAHLILATNAEGELMKQYSAIIHHDPGAAFGLTFPDLPGCFAAADCWDDVPKAASEALNLWFEDQPEVPPSPLDALLK
RQDVAQALAEGATLITIPYIPADGTLERVNISIERGLLRAVDAAAKERGMTRSSFLASAARHELTGA
Download Length: 444 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|