Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 1375948..1376556 Replicon chromosome
Accession NZ_CP102352
Organism Paracoccus sp. SMMA_5

Toxin (Protein)


Gene name hicA Uniprot ID A0A7X2NZ63
Locus tag GB879_RS06935 Protein ID WP_028716902.1
Coordinates 1376368..1376556 (-) Length 63 a.a.

Antitoxin (Protein)


Gene name hicA Uniprot ID A0A7X2NZI5
Locus tag GB879_RS06930 Protein ID WP_028716903.1
Coordinates 1375948..1376355 (-) Length 136 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
GB879_RS06880 (GB879_006880) 1371034..1371444 - 411 WP_263466989.1 hypothetical protein -
GB879_RS06885 (GB879_006885) 1371446..1371760 - 315 WP_154494122.1 hypothetical protein -
GB879_RS06890 (GB879_006890) 1371894..1372064 - 171 WP_154494121.1 hypothetical protein -
GB879_RS06895 (GB879_006895) 1372114..1372500 - 387 WP_154494120.1 hypothetical protein -
GB879_RS06900 (GB879_006900) 1372497..1372763 - 267 WP_154494119.1 hypothetical protein -
GB879_RS06905 (GB879_006905) 1373109..1373435 - 327 WP_154494118.1 hypothetical protein -
GB879_RS06910 (GB879_006910) 1373713..1374378 - 666 WP_154494117.1 S24 family peptidase -
GB879_RS06915 (GB879_006915) 1374463..1374678 + 216 WP_154494116.1 hypothetical protein -
GB879_RS06920 (GB879_006920) 1374759..1375028 + 270 WP_028716904.1 hypothetical protein -
GB879_RS06925 (GB879_006925) 1375701..1375961 - 261 WP_154494115.1 hypothetical protein -
GB879_RS06930 (GB879_006930) 1375948..1376355 - 408 WP_028716903.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
GB879_RS06935 (GB879_006935) 1376368..1376556 - 189 WP_028716902.1 type II toxin-antitoxin system HicA family toxin Toxin
GB879_RS06940 (GB879_006940) 1376737..1376967 - 231 WP_154494114.1 hypothetical protein -
GB879_RS06945 (GB879_006945) 1377180..1378058 + 879 WP_154494113.1 hypothetical protein -
GB879_RS06950 (GB879_006950) 1378065..1379075 + 1011 WP_154494112.1 helix-turn-helix domain-containing protein -
GB879_RS06955 (GB879_006955) 1379072..1379428 + 357 WP_154494111.1 hypothetical protein -
GB879_RS06960 (GB879_006960) 1379566..1379796 + 231 WP_154494110.1 hypothetical protein -
GB879_RS06965 (GB879_006965) 1379805..1380209 + 405 WP_195840834.1 VRR-NUC domain-containing protein -
GB879_RS06970 (GB879_006970) 1380206..1380898 + 693 WP_154494108.1 hypothetical protein -
GB879_RS06975 (GB879_006975) 1380903..1381508 + 606 WP_154494107.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(5-61)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(3-127)


Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7264.47 Da        Isoelectric Point: 11.1468

>T253467 WP_028716902.1 NZ_CP102352:c1376556-1376368 [Paracoccus sp. SMMA_5]
MERNSRKLIKMLEADGWVRVAVKGDHWQFKHPEKPGRVTVPHPNKDIKPGTVMSIYRQAGWR

Download         Length: 189 bp

Antitoxin


Download         Length: 136 a.a.        Molecular weight: 14416.13 Da        Isoelectric Point: 4.6144

>AT253467 WP_028716903.1 NZ_CP102352:c1376355-1375948 [Paracoccus sp. SMMA_5]
MRYVAFLHTDEAGGFGISFPDFPGAISDGDTVEQAIQRGEQALAFHVQGMREDGLDVPAPRSVDDILADPALAEWREGAQ
IAHVALILDRGSPKRVNISLDPGLLDAIDAEAARRGMTRSAFLSSAARAEIHAAH

Download         Length: 408 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7X2NZ63

Antitoxin

Source ID Structure
AlphaFold DB A0A7X2NZI5

References