Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | spoIISABC/SpoIISA-SpoIISB |
Location | 1299748..1300665 | Replicon | chromosome |
Accession | NZ_CP102350 | ||
Organism | Bacillus velezensis strain PMC206 |
Toxin (Protein)
Gene name | spoIISA | Uniprot ID | A0A6A8LGT8 |
Locus tag | NRF13_RS07055 | Protein ID | WP_003154806.1 |
Coordinates | 1299919..1300665 (-) | Length | 249 a.a. |
Antitoxin (Protein)
Gene name | spoIISB | Uniprot ID | I2HQ14 |
Locus tag | NRF13_RS07050 | Protein ID | WP_003154807.1 |
Coordinates | 1299748..1299918 (-) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NRF13_RS07010 (NRF13_07010) | 1294979..1296601 | + | 1623 | WP_058905960.1 | pyocin knob domain-containing protein | - |
NRF13_RS07015 (NRF13_07015) | 1296614..1296985 | + | 372 | WP_014304856.1 | XkdW family protein | - |
NRF13_RS07020 (NRF13_07020) | 1296991..1297188 | + | 198 | WP_003154819.1 | XkdX family protein | - |
NRF13_RS07025 (NRF13_07025) | 1297245..1298006 | + | 762 | WP_058905961.1 | hypothetical protein | - |
NRF13_RS07030 (NRF13_07030) | 1298058..1298321 | + | 264 | WP_003154815.1 | hemolysin XhlA family protein | - |
NRF13_RS07035 (NRF13_07035) | 1298335..1298598 | + | 264 | WP_003154813.1 | phage holin | - |
NRF13_RS07040 (NRF13_07040) | 1298612..1299490 | + | 879 | WP_058905962.1 | N-acetylmuramoyl-L-alanine amidase | - |
NRF13_RS07045 (NRF13_07045) | 1299526..1299651 | - | 126 | WP_003154809.1 | hypothetical protein | - |
NRF13_RS07050 (NRF13_07050) | 1299748..1299918 | - | 171 | WP_003154807.1 | type II toxin-antitoxin system SpoIISB family antitoxin | Antitoxin |
NRF13_RS07055 (NRF13_07055) | 1299919..1300665 | - | 747 | WP_003154806.1 | type II toxin-antitoxin system SpoIISA family toxin | Toxin |
NRF13_RS07060 (NRF13_07060) | 1300770..1301768 | - | 999 | WP_003154805.1 | inorganic phosphate transporter | - |
NRF13_RS07065 (NRF13_07065) | 1301781..1302398 | - | 618 | WP_003154804.1 | DUF47 domain-containing protein | - |
NRF13_RS07070 (NRF13_07070) | 1302684..1304000 | - | 1317 | WP_003154801.1 | amino acid permease | - |
NRF13_RS07075 (NRF13_07075) | 1304323..1305273 | + | 951 | WP_015388352.1 | ring-cleaving dioxygenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 249 a.a. Molecular weight: 29034.50 Da Isoelectric Point: 4.6947
>T253466 WP_003154806.1 NZ_CP102350:c1300665-1299919 [Bacillus velezensis]
MLLFFQIMVWTMAAALILYVYASWRYEAKVKEKMFAIRKTWYLLFVVGAMVYWTYDPESLFAAWRQYLIVAVCFALIDAF
IFLSAYIKKLAGNELETDTREILEENNEMLHSYLEKLKTYQYLLKNEPIHVYYGSTEAYAEGISRLLAAYGEKMNVTASL
CDYSAQSDKDRLTEHMPDAADVQSRLNRKDVYYDQKGRLVLIPFTVQDRHYVIKLTSENLLTEFDYLLFTSLTSIYDLML
PIEEEGDG
MLLFFQIMVWTMAAALILYVYASWRYEAKVKEKMFAIRKTWYLLFVVGAMVYWTYDPESLFAAWRQYLIVAVCFALIDAF
IFLSAYIKKLAGNELETDTREILEENNEMLHSYLEKLKTYQYLLKNEPIHVYYGSTEAYAEGISRLLAAYGEKMNVTASL
CDYSAQSDKDRLTEHMPDAADVQSRLNRKDVYYDQKGRLVLIPFTVQDRHYVIKLTSENLLTEFDYLLFTSLTSIYDLML
PIEEEGDG
Download Length: 747 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A6A8LGT8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | I2HQ14 |