Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 482364..483001 | Replicon | chromosome |
Accession | NZ_CP102350 | ||
Organism | Bacillus velezensis strain PMC206 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | G4NU33 |
Locus tag | NRF13_RS02580 | Protein ID | WP_003156187.1 |
Coordinates | 482651..483001 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | I2HMS5 |
Locus tag | NRF13_RS02575 | Protein ID | WP_003156188.1 |
Coordinates | 482364..482645 (+) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NRF13_RS02555 (NRF13_02555) | 478730..479329 | - | 600 | WP_003156193.1 | rhomboid family intramembrane serine protease | - |
NRF13_RS02560 (NRF13_02560) | 479422..479787 | + | 366 | WP_014304402.1 | holo-ACP synthase | - |
NRF13_RS02565 (NRF13_02565) | 479951..480958 | + | 1008 | WP_003156191.1 | outer membrane lipoprotein carrier protein LolA | - |
NRF13_RS02570 (NRF13_02570) | 481075..482244 | + | 1170 | WP_058906584.1 | alanine racemase | - |
NRF13_RS02575 (NRF13_02575) | 482364..482645 | + | 282 | WP_003156188.1 | type II toxin-antitoxin system antitoxin EndoAI | Antitoxin |
NRF13_RS02580 (NRF13_02580) | 482651..483001 | + | 351 | WP_003156187.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
NRF13_RS02585 (NRF13_02585) | 483119..483940 | + | 822 | WP_014304404.1 | STAS domain-containing protein | - |
NRF13_RS02590 (NRF13_02590) | 483945..484310 | + | 366 | WP_003156180.1 | RsbT antagonist protein RsbS | - |
NRF13_RS02595 (NRF13_02595) | 484313..484714 | + | 402 | WP_003156178.1 | anti-sigma regulatory factor | - |
NRF13_RS02600 (NRF13_02600) | 484726..485733 | + | 1008 | WP_003156177.1 | PP2C family protein-serine/threonine phosphatase | - |
NRF13_RS02605 (NRF13_02605) | 485797..486126 | + | 330 | WP_003156176.1 | anti-sigma factor antagonist RsbV | - |
NRF13_RS02610 (NRF13_02610) | 486123..486605 | + | 483 | WP_003156173.1 | anti-sigma B factor RsbW | - |
NRF13_RS02615 (NRF13_02615) | 486571..487359 | + | 789 | WP_003156171.1 | RNA polymerase sigma factor SigB | - |
NRF13_RS02620 (NRF13_02620) | 487359..487961 | + | 603 | WP_003156170.1 | PP2C family serine/threonine-protein phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12977.98 Da Isoelectric Point: 4.8781
>T253465 WP_003156187.1 NZ_CP102350:482651-483001 [Bacillus velezensis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|