Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | unclassified/Polyketide_cyc2(toxin) |
| Location | 5733783..5734424 | Replicon | chromosome |
| Accession | NZ_CP102347 | ||
| Organism | Mycolicibacterium smegmatis strain LM14 | ||
Toxin (Protein)
| Gene name | novel[antitoxin] | Uniprot ID | - |
| Locus tag | NQ427_RS27295 | Protein ID | WP_011730672.1 |
| Coordinates | 5733783..5734226 (-) | Length | 148 a.a. |
Antitoxin (Protein)
| Gene name | novel[toxin] | Uniprot ID | I7FKW8 |
| Locus tag | NQ427_RS27300 | Protein ID | WP_011730673.1 |
| Coordinates | 5734236..5734424 (-) | Length | 63 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NQ427_RS27275 (NQ427_27275) | 5729266..5730003 | + | 738 | WP_011730668.1 | GntR family transcriptional regulator | - |
| NQ427_RS27280 (NQ427_27280) | 5730005..5731537 | + | 1533 | WP_011730669.1 | cyclohexanecarboxylate-CoA ligase | - |
| NQ427_RS27285 (NQ427_27285) | 5731538..5732311 | + | 774 | WP_011730670.1 | SDR family oxidoreductase | - |
| NQ427_RS27290 (NQ427_27290) | 5732308..5733780 | + | 1473 | WP_011730671.1 | long-chain fatty acid--CoA ligase | - |
| NQ427_RS27295 (NQ427_27295) | 5733783..5734226 | - | 444 | WP_011730672.1 | SRPBCC family protein | Toxin |
| NQ427_RS27300 (NQ427_27300) | 5734236..5734424 | - | 189 | WP_011730673.1 | antitoxin | Antitoxin |
| NQ427_RS27305 (NQ427_27305) | 5734450..5736825 | - | 2376 | WP_011730674.1 | cation-translocating P-type ATPase | - |
| NQ427_RS27310 (NQ427_27310) | 5736839..5738446 | - | 1608 | WP_162139558.1 | serine hydrolase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 148 a.a. Molecular weight: 16157.75 Da Isoelectric Point: 9.9432
>T253464 WP_011730672.1 NZ_CP102347:c5734226-5733783 [Mycolicibacterium smegmatis]
MAKLSVSVEVPLPPEQAWEYASDLSRYHEWLSIHRAWRSKLPETLEKGTVIESIVEVKGMLNRVRWTLVHYKPPQALTLN
GDGRGGVKVKLIGKIKPTDNGATVGFDLHLGGPALFGPIGMVVAAALKSDIQESLNRFKQLYAPSAT
MAKLSVSVEVPLPPEQAWEYASDLSRYHEWLSIHRAWRSKLPETLEKGTVIESIVEVKGMLNRVRWTLVHYKPPQALTLN
GDGRGGVKVKLIGKIKPTDNGATVGFDLHLGGPALFGPIGMVVAAALKSDIQESLNRFKQLYAPSAT
Download Length: 444 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|