Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | phd-doc/Fic(toxin) |
| Location | 1369876..1370462 | Replicon | chromosome |
| Accession | NZ_CP102347 | ||
| Organism | Mycolicibacterium smegmatis strain LM14 | ||
Toxin (Protein)
| Gene name | doc | Uniprot ID | A0A8B4QHV5 |
| Locus tag | NQ427_RS06300 | Protein ID | WP_011727560.1 |
| Coordinates | 1370070..1370462 (+) | Length | 131 a.a. |
Antitoxin (Protein)
| Gene name | phd | Uniprot ID | A0A2U9PKT9 |
| Locus tag | NQ427_RS06295 | Protein ID | WP_011727559.1 |
| Coordinates | 1369876..1370073 (+) | Length | 66 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NQ427_RS06270 (NQ427_06270) | 1364909..1366387 | - | 1479 | WP_011727554.1 | ADP-ribosylglycohydrolase family protein | - |
| NQ427_RS06275 (NQ427_06275) | 1366576..1366917 | - | 342 | WP_011727555.1 | DUF732 domain-containing protein | - |
| NQ427_RS06280 (NQ427_06280) | 1366977..1368050 | - | 1074 | WP_228025495.1 | SMP-30/gluconolactonase/LRE family protein | - |
| NQ427_RS06285 (NQ427_06285) | 1368285..1369364 | - | 1080 | WP_011727557.1 | HNH endonuclease domain-containing protein | - |
| NQ427_RS06290 (NQ427_06290) | 1369432..1369728 | + | 297 | WP_011727558.1 | nucleoside triphosphate pyrophosphohydrolase | - |
| NQ427_RS06295 (NQ427_06295) | 1369876..1370073 | + | 198 | WP_011727559.1 | type II toxin-antitoxin system antitoxin Phd | Antitoxin |
| NQ427_RS06300 (NQ427_06300) | 1370070..1370462 | + | 393 | WP_011727560.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
| NQ427_RS06305 (NQ427_06305) | 1370539..1371969 | + | 1431 | WP_003892661.1 | DUF3375 domain-containing protein | - |
| NQ427_RS06310 (NQ427_06310) | 1371984..1372688 | + | 705 | WP_234882670.1 | DUF4194 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 131 a.a. Molecular weight: 13939.57 Da Isoelectric Point: 4.2481
>T253460 WP_011727560.1 NZ_CP102347:1370070-1370462 [Mycolicibacterium smegmatis]
VTEYLDREDVLTAGSIAFGGELKVRDYGLLDAAVARPQATVYGVDAYPRLWDKAAALLQSLARNHALVDGNKRTAWAAAW
TFLHINGVQLAADFDVDRAEDLMNEVATRDCDLDSIAAELAGFAAAAQTG
VTEYLDREDVLTAGSIAFGGELKVRDYGLLDAAVARPQATVYGVDAYPRLWDKAAALLQSLARNHALVDGNKRTAWAAAW
TFLHINGVQLAADFDVDRAEDLMNEVATRDCDLDSIAAELAGFAAAAQTG
Download Length: 393 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A8B4QHV5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2U9PKT9 |