Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PemK-MazE |
| Location | 4541229..4541770 | Replicon | chromosome |
| Accession | NZ_CP102344 | ||
| Organism | Mycolicibacterium smegmatis strain LM12 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | A0A2U9PVI3 |
| Locus tag | NQ425_RS21615 | Protein ID | WP_003895797.1 |
| Coordinates | 4541441..4541770 (+) | Length | 110 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | A0R0N3 |
| Locus tag | NQ425_RS21610 | Protein ID | WP_011729843.1 |
| Coordinates | 4541229..4541438 (+) | Length | 70 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NQ425_RS21585 (NQ425_21585) | 4536500..4537270 | - | 771 | WP_011729837.1 | SDR family oxidoreductase | - |
| NQ425_RS21590 (NQ425_21590) | 4537807..4538208 | - | 402 | Protein_4290 | cupin domain-containing protein | - |
| NQ425_RS21595 (NQ425_21595) | 4538238..4539158 | - | 921 | WP_011729840.1 | NADP-dependent oxidoreductase | - |
| NQ425_RS21600 (NQ425_21600) | 4539155..4539439 | - | 285 | WP_011729841.1 | hypothetical protein | - |
| NQ425_RS21605 (NQ425_21605) | 4539701..4541068 | + | 1368 | WP_014878037.1 | dihydrolipoyl dehydrogenase | - |
| NQ425_RS21610 (NQ425_21610) | 4541229..4541438 | + | 210 | WP_011729843.1 | antitoxin MazE family protein | Antitoxin |
| NQ425_RS21615 (NQ425_21615) | 4541441..4541770 | + | 330 | WP_003895797.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| NQ425_RS21620 (NQ425_21620) | 4541813..4542376 | - | 564 | WP_014878038.1 | helix-turn-helix domain-containing protein | - |
| NQ425_RS21625 (NQ425_21625) | 4542482..4543417 | + | 936 | WP_003895799.1 | alpha/beta fold hydrolase | - |
| NQ425_RS21630 (NQ425_21630) | 4543414..4545126 | + | 1713 | WP_011729844.1 | NAD(P)/FAD-dependent oxidoreductase | - |
| NQ425_RS21640 (NQ425_21640) | 4545343..4545723 | + | 381 | WP_029104585.1 | phage holin family protein | - |
| NQ425_RS21645 (NQ425_21645) | 4545741..4546766 | + | 1026 | WP_014878040.1 | aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 110 a.a. Molecular weight: 11739.52 Da Isoelectric Point: 10.4023
>T253448 WP_003895797.1 NZ_CP102344:4541441-4541770 [Mycolicibacterium smegmatis]
VRRGDIYTAAARGAYTGKPRPVLIIQDDRFDATASVTVVPFTTSDTDAPLLRIRIEPTPATGLSTVSSLMIDKVTTVPRS
SLTHRVGRLAETDMVRTDRALLVFLGIAG
VRRGDIYTAAARGAYTGKPRPVLIIQDDRFDATASVTVVPFTTSDTDAPLLRIRIEPTPATGLSTVSSLMIDKVTTVPRS
SLTHRVGRLAETDMVRTDRALLVFLGIAG
Download Length: 330 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2U9PVI3 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0R0N3 |