Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC(toxin) |
Location | 1377107..1377750 | Replicon | chromosome |
Accession | NZ_CP102344 | ||
Organism | Mycolicibacterium smegmatis strain LM12 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | A0A8B4QHE7 |
Locus tag | NQ425_RS06330 | Protein ID | WP_011727564.1 |
Coordinates | 1377361..1377750 (+) | Length | 130 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | A0QRY5 |
Locus tag | NQ425_RS06325 | Protein ID | WP_003892665.1 |
Coordinates | 1377107..1377361 (+) | Length | 85 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NQ425_RS06315 (NQ425_06315) | 1372573..1375920 | + | 3348 | WP_014877022.1 | ATP-binding protein | - |
NQ425_RS06320 (NQ425_06320) | 1375917..1377086 | + | 1170 | WP_011727563.1 | DUF3322 and DUF2220 domain-containing protein | - |
NQ425_RS06325 (NQ425_06325) | 1377107..1377361 | + | 255 | WP_003892665.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
NQ425_RS06330 (NQ425_06330) | 1377361..1377750 | + | 390 | WP_011727564.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
NQ425_RS06335 (NQ425_06335) | 1377769..1380174 | - | 2406 | WP_011727565.1 | SEC-C metal-binding domain-containing protein | - |
NQ425_RS06340 (NQ425_06340) | 1380196..1381956 | - | 1761 | WP_011727566.1 | sulfatase-like hydrolase/transferase | - |
NQ425_RS06345 (NQ425_06345) | 1381953..1382390 | - | 438 | WP_011727567.1 | SRPBCC family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 130 a.a. Molecular weight: 13909.73 Da Isoelectric Point: 4.7222
>T253446 WP_011727564.1 NZ_CP102344:1377361-1377750 [Mycolicibacterium smegmatis]
MVIDTSALVAILTDEPDAELLEGAVADDPVRTMSTASYLETAIVIESRFGEPGGRELDLWLHRASVALVAVDADQADAAR
LAYRRYGKGRHRAGLNYGDCFSYALAKVSGQPLLFKGEAFRLTDVAAVH
MVIDTSALVAILTDEPDAELLEGAVADDPVRTMSTASYLETAIVIESRFGEPGGRELDLWLHRASVALVAVDADQADAAR
LAYRRYGKGRHRAGLNYGDCFSYALAKVSGQPLLFKGEAFRLTDVAAVH
Download Length: 390 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A8B4QHE7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0QRY5 |