Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-YafN |
| Location | 2807467..2807986 | Replicon | chromosome |
| Accession | NZ_CP102330 | ||
| Organism | Burkholderia cepacia strain N3009-2YT | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | A0A2X1HSN6 |
| Locus tag | NQK75_RS29365 | Protein ID | WP_059495132.1 |
| Coordinates | 2807467..2807748 (-) | Length | 94 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | A0A2X1IH73 |
| Locus tag | NQK75_RS29370 | Protein ID | WP_059495134.1 |
| Coordinates | 2807738..2807986 (-) | Length | 83 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NQK75_RS29345 | 2803197..2803895 | - | 699 | WP_021159681.1 | MgtC/SapB family protein | - |
| NQK75_RS29350 | 2804010..2805119 | + | 1110 | WP_069255048.1 | AGE family epimerase/isomerase | - |
| NQK75_RS29355 | 2805092..2806711 | - | 1620 | WP_257250083.1 | methyl-accepting chemotaxis protein | - |
| NQK75_RS29360 | 2806983..2807426 | + | 444 | WP_059523219.1 | PaaI family thioesterase | - |
| NQK75_RS29365 | 2807467..2807748 | - | 282 | WP_059495132.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NQK75_RS29370 | 2807738..2807986 | - | 249 | WP_059495134.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Antitoxin |
| NQK75_RS29375 | 2808109..2809161 | - | 1053 | WP_257250084.1 | CaiB/BaiF CoA-transferase family protein | - |
| NQK75_RS29380 | 2809357..2810550 | - | 1194 | WP_059495147.1 | 2-methylaconitate cis-trans isomerase PrpF | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10928.89 Da Isoelectric Point: 10.6474
>T253434 WP_059495132.1 NZ_CP102330:c2807748-2807467 [Burkholderia cepacia]
MTFELAFLEPALKEWKKLDRTVRDQFKAKLAERLEHPRIPSAKLHGHPDRYKIKLRGVGYRLVYEVRDAEVIVLVVAVGR
RERDAVYLAAMKR
MTFELAFLEPALKEWKKLDRTVRDQFKAKLAERLEHPRIPSAKLHGHPDRYKIKLRGVGYRLVYEVRDAEVIVLVVAVGR
RERDAVYLAAMKR
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2X1HSN6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2X1IH73 |