Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-StbC |
| Location | 1989851..1990506 | Replicon | chromosome |
| Accession | NZ_CP102330 | ||
| Organism | Burkholderia cepacia strain N3009-2YT | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | U2HGC0 |
| Locus tag | NQK75_RS25735 | Protein ID | WP_021158162.1 |
| Coordinates | 1989851..1990270 (-) | Length | 140 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | U2HMP5 |
| Locus tag | NQK75_RS25740 | Protein ID | WP_021158161.1 |
| Coordinates | 1990267..1990506 (-) | Length | 80 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NQK75_RS25705 | 1985140..1985934 | + | 795 | WP_021158168.1 | AraC family transcriptional regulator | - |
| NQK75_RS25710 | 1985903..1986271 | - | 369 | WP_257249863.1 | hypothetical protein | - |
| NQK75_RS25715 | 1986270..1987223 | + | 954 | WP_059619447.1 | DMT family transporter | - |
| NQK75_RS25720 | 1987409..1987957 | + | 549 | WP_021158166.1 | hypothetical protein | - |
| NQK75_RS25725 | 1988052..1988186 | - | 135 | WP_021158165.1 | entericidin A/B family lipoprotein | - |
| NQK75_RS25730 | 1988420..1989715 | + | 1296 | WP_059587044.1 | aspartate carbamoyltransferase | - |
| NQK75_RS25735 | 1989851..1990270 | - | 420 | WP_021158162.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| NQK75_RS25740 | 1990267..1990506 | - | 240 | WP_021158161.1 | antitoxin VapB | Antitoxin |
| NQK75_RS25745 | 1990817..1993063 | + | 2247 | WP_257249864.1 | TonB-dependent siderophore receptor | - |
| NQK75_RS25750 | 1993067..1993834 | + | 768 | WP_059677526.1 | tetratricopeptide repeat protein | - |
| NQK75_RS25755 | 1993831..1994514 | + | 684 | WP_021158158.1 | Fe2+-dependent dioxygenase | - |
| NQK75_RS25760 | 1994603..1994842 | + | 240 | WP_011659184.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
| NQK75_RS25765 | 1994839..1995234 | + | 396 | WP_042973908.1 | type II toxin-antitoxin system VapC family toxin | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 15212.57 Da Isoelectric Point: 5.9052
>T253432 WP_021158162.1 NZ_CP102330:c1990270-1989851 [Burkholderia cepacia]
MILVDTNVISEPLRREPNAAVIEWLDAQNVETLFLAAISLAEIRLGVAVLPEGRRREWLHQSIEQRVLPLFRGRILPFDD
AASKAYASLRARARAAGVAIAPSDGFIAGTAEANGLIVATRDVTPFEAMGIRVIDPWAR
MILVDTNVISEPLRREPNAAVIEWLDAQNVETLFLAAISLAEIRLGVAVLPEGRRREWLHQSIEQRVLPLFRGRILPFDD
AASKAYASLRARARAAGVAIAPSDGFIAGTAEANGLIVATRDVTPFEAMGIRVIDPWAR
Download Length: 420 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|