Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC-StbC
Location 1989851..1990506 Replicon chromosome
Accession NZ_CP102330
Organism Burkholderia cepacia strain N3009-2YT

Toxin (Protein)


Gene name vapC Uniprot ID U2HGC0
Locus tag NQK75_RS25735 Protein ID WP_021158162.1
Coordinates 1989851..1990270 (-) Length 140 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID U2HMP5
Locus tag NQK75_RS25740 Protein ID WP_021158161.1
Coordinates 1990267..1990506 (-) Length 80 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NQK75_RS25705 1985140..1985934 + 795 WP_021158168.1 AraC family transcriptional regulator -
NQK75_RS25710 1985903..1986271 - 369 WP_257249863.1 hypothetical protein -
NQK75_RS25715 1986270..1987223 + 954 WP_059619447.1 DMT family transporter -
NQK75_RS25720 1987409..1987957 + 549 WP_021158166.1 hypothetical protein -
NQK75_RS25725 1988052..1988186 - 135 WP_021158165.1 entericidin A/B family lipoprotein -
NQK75_RS25730 1988420..1989715 + 1296 WP_059587044.1 aspartate carbamoyltransferase -
NQK75_RS25735 1989851..1990270 - 420 WP_021158162.1 type II toxin-antitoxin system VapC family toxin Toxin
NQK75_RS25740 1990267..1990506 - 240 WP_021158161.1 antitoxin VapB Antitoxin
NQK75_RS25745 1990817..1993063 + 2247 WP_257249864.1 TonB-dependent siderophore receptor -
NQK75_RS25750 1993067..1993834 + 768 WP_059677526.1 tetratricopeptide repeat protein -
NQK75_RS25755 1993831..1994514 + 684 WP_021158158.1 Fe2+-dependent dioxygenase -
NQK75_RS25760 1994603..1994842 + 240 WP_011659184.1 type II toxin-antitoxin system Phd/YefM family antitoxin -
NQK75_RS25765 1994839..1995234 + 396 WP_042973908.1 type II toxin-antitoxin system VapC family toxin -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(2-122)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 140 a.a.        Molecular weight: 15212.57 Da        Isoelectric Point: 5.9052

>T253432 WP_021158162.1 NZ_CP102330:c1990270-1989851 [Burkholderia cepacia]
MILVDTNVISEPLRREPNAAVIEWLDAQNVETLFLAAISLAEIRLGVAVLPEGRRREWLHQSIEQRVLPLFRGRILPFDD
AASKAYASLRARARAAGVAIAPSDGFIAGTAEANGLIVATRDVTPFEAMGIRVIDPWAR

Download         Length: 420 bp

Antitoxin


Download         Length: 80 a.a.        Molecular weight: 8629.79 Da        Isoelectric Point: 5.6643

>AT253432 WP_021158161.1 NZ_CP102330:c1990506-1990267 [Burkholderia cepacia]
MPVITVRNLSDEVHRALRIRAAQHGRSTEAEVRDILEQAVLPGGRLKLGTMLAAIGQEAGGFDFDAQRDKTPADPMSFE

Download         Length: 240 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB U2HGC0

Antitoxin

Source ID Structure
AlphaFold DB U2HMP5

References