Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | phd-doc/HTH_IclR(antitoxin) |
Location | 1814040..1815790 | Replicon | chromosome |
Accession | NZ_CP102330 | ||
Organism | Burkholderia cepacia strain N3009-2YT |
Toxin (Protein)
Gene name | doc | Uniprot ID | - |
Locus tag | NQK75_RS24910 | Protein ID | WP_257249803.1 |
Coordinates | 1814894..1815790 (-) | Length | 299 a.a. |
Antitoxin (Protein)
Gene name | phd | Uniprot ID | A0A365QHE5 |
Locus tag | NQK75_RS24905 | Protein ID | WP_059497041.1 |
Coordinates | 1814040..1814897 (-) | Length | 286 a.a. |
Genomic Context
Location: 1819369..1820448 (1080 bp)
Type: Others
Protein ID: WP_176130833.1
Type: Others
Protein ID: WP_176130833.1
Location: 1809203..1810693 (1491 bp)
Type: Others
Protein ID: WP_059484807.1
Type: Others
Protein ID: WP_059484807.1
Location: 1810766..1811593 (828 bp)
Type: Others
Protein ID: WP_021161508.1
Type: Others
Protein ID: WP_021161508.1
Location: 1811586..1813253 (1668 bp)
Type: Others
Protein ID: WP_257249800.1
Type: Others
Protein ID: WP_257249800.1
Location: 1813246..1814043 (798 bp)
Type: Others
Protein ID: WP_257249801.1
Type: Others
Protein ID: WP_257249801.1
Location: 1814040..1814897 (858 bp)
Type: Antitoxin
Protein ID: WP_059497041.1
Type: Antitoxin
Protein ID: WP_059497041.1
Location: 1814894..1815790 (897 bp)
Type: Toxin
Protein ID: WP_257249803.1
Type: Toxin
Protein ID: WP_257249803.1
Location: 1815809..1816336 (528 bp)
Type: Others
Protein ID: WP_021161513.1
Type: Others
Protein ID: WP_021161513.1
Location: 1816375..1817145 (771 bp)
Type: Others
Protein ID: WP_048022637.1
Type: Others
Protein ID: WP_048022637.1
Location: 1817138..1818208 (1071 bp)
Type: Others
Protein ID: WP_021161515.1
Type: Others
Protein ID: WP_021161515.1
Location: 1818291..1818602 (312 bp)
Type: Others
Protein ID: WP_059484801.1
Type: Others
Protein ID: WP_059484801.1
Location: 1818606..1818923 (318 bp)
Type: Others
Protein ID: WP_021161517.1
Type: Others
Protein ID: WP_021161517.1
Location: 1819018..1819344 (327 bp)
Type: Others
Protein ID: WP_257249804.1
Type: Others
Protein ID: WP_257249804.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NQK75_RS24885 | 1809203..1810693 | - | 1491 | WP_059484807.1 | aldehyde dehydrogenase | - |
NQK75_RS24890 | 1810766..1811593 | - | 828 | WP_021161508.1 | aspartate dehydrogenase | - |
NQK75_RS24895 | 1811586..1813253 | - | 1668 | WP_257249800.1 | thiamine pyrophosphate-binding protein | - |
NQK75_RS24900 | 1813246..1814043 | - | 798 | WP_257249801.1 | SDR family oxidoreductase | - |
NQK75_RS24905 | 1814040..1814897 | - | 858 | WP_059497041.1 | IclR family transcriptional regulator | Antitoxin |
NQK75_RS24910 | 1814894..1815790 | - | 897 | WP_257249803.1 | alpha/beta fold hydrolase | Toxin |
NQK75_RS24915 | 1815809..1816336 | - | 528 | WP_021161513.1 | cupin domain-containing protein | - |
NQK75_RS24920 | 1816375..1817145 | - | 771 | WP_048022637.1 | SDR family oxidoreductase | - |
NQK75_RS24925 | 1817138..1818208 | - | 1071 | WP_021161515.1 | aromatic ring-hydroxylating dioxygenase subunit alpha | - |
NQK75_RS24930 | 1818291..1818602 | - | 312 | WP_059484801.1 | hypothetical protein | - |
NQK75_RS24935 | 1818606..1818923 | - | 318 | WP_021161517.1 | non-heme iron oxygenase ferredoxin subunit | - |
NQK75_RS24940 | 1819018..1819344 | - | 327 | WP_257249804.1 | hypothetical protein | - |
NQK75_RS24945 | 1819369..1820448 | + | 1080 | WP_176130833.1 | porin | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
No matching records found |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 299 a.a. Molecular weight: 30559.77 Da Isoelectric Point: 7.7326
>T253431 WP_257249803.1 NZ_CP102330:c1815790-1814894 [Burkholderia cepacia]
MSVIDKRERDRTAAFAALLGQFPEQRCAAGAAGTIGYREAGAQHGGRALPVVLLHGIGSGAASWVSQLDTLGASRRVLAW
DAPGYGVSTPVHGASPAAADYAAALNAWLEALGIERCVLVGHSLGAIIAGGLARVMPARIAGLLLISPAGGYGSAPADTR
ESRRDARLAMLAELGPAGLAEQRSGNMLSGFANEDARAWVRWNMARIVPAGYAQATHLLANADLAADLAGFRGRTAVAVG
ANDAITPPAACERIAAAAHVGLQVIPQAGHAGYVEAPAVYSALIDTFCRQCDQQRGLA
MSVIDKRERDRTAAFAALLGQFPEQRCAAGAAGTIGYREAGAQHGGRALPVVLLHGIGSGAASWVSQLDTLGASRRVLAW
DAPGYGVSTPVHGASPAAADYAAALNAWLEALGIERCVLVGHSLGAIIAGGLARVMPARIAGLLLISPAGGYGSAPADTR
ESRRDARLAMLAELGPAGLAEQRSGNMLSGFANEDARAWVRWNMARIVPAGYAQATHLLANADLAADLAGFRGRTAVAVG
ANDAITPPAACERIAAAAHVGLQVIPQAGHAGYVEAPAVYSALIDTFCRQCDQQRGLA
Download Length: 897 bp
Antitoxin
Download Length: 286 a.a. Molecular weight: 31546.09 Da Isoelectric Point: 6.6572
>AT253431 WP_059497041.1 NZ_CP102330:c1814897-1814040 [Burkholderia cepacia]
MNEPLQRPEPENDKAEASYVVPGLERGLRILAEFSPREPVLGAPELSKRLGIPRTTVFRLLQTLESLGFLERADKDRNYK
LGIAVLRLGFEYLSSLELTDLGLPVIESLRDATGFTTHIVIRDGRDVVFVAKAQSQSPVFSSIRVNVGTRLPAHATTHGH
VLMGDLSLKELRSLYPEGTLNRMTNATPETVDALYEVIREDALRGYGVSNSSFERGISVVTAPVRNETQKIVACITVTVP
RPEIDAALIADGLIDKVQRAAAELSRRLNYRSDDEHTFMKALGLR
MNEPLQRPEPENDKAEASYVVPGLERGLRILAEFSPREPVLGAPELSKRLGIPRTTVFRLLQTLESLGFLERADKDRNYK
LGIAVLRLGFEYLSSLELTDLGLPVIESLRDATGFTTHIVIRDGRDVVFVAKAQSQSPVFSSIRVNVGTRLPAHATTHGH
VLMGDLSLKELRSLYPEGTLNRMTNATPETVDALYEVIREDALRGYGVSNSSFERGISVVTAPVRNETQKIVACITVTVP
RPEIDAALIADGLIDKVQRAAAELSRRLNYRSDDEHTFMKALGLR
Download Length: 858 bp
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
No matching records found |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A365QHE5 |