Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
| Location | 791491..792068 | Replicon | chromosome |
| Accession | NZ_CP102330 | ||
| Organism | Burkholderia cepacia strain N3009-2YT | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | U2G063 |
| Locus tag | NQK75_RS20490 | Protein ID | WP_021160897.1 |
| Coordinates | 791491..791856 (-) | Length | 122 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | U2HEK9 |
| Locus tag | NQK75_RS20495 | Protein ID | WP_021160898.1 |
| Coordinates | 791850..792068 (-) | Length | 73 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NQK75_RS20470 | 787120..787674 | + | 555 | WP_257250516.1 | carboxymuconolactone decarboxylase family protein | - |
| NQK75_RS20475 | 787835..788635 | + | 801 | WP_257250517.1 | extensin | - |
| NQK75_RS20480 | 788871..790469 | - | 1599 | WP_059552487.1 | alkyl hydroperoxide reductase subunit F | - |
| NQK75_RS20485 | 790592..791155 | - | 564 | WP_006488685.1 | alkyl hydroperoxide reductase subunit C | - |
| NQK75_RS20490 | 791491..791856 | - | 366 | WP_021160897.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| NQK75_RS20495 | 791850..792068 | - | 219 | WP_021160898.1 | hypothetical protein | Antitoxin |
| NQK75_RS20500 | 792159..793055 | - | 897 | WP_048026027.1 | LysR substrate-binding domain-containing protein | - |
| NQK75_RS20505 | 793233..794399 | + | 1167 | WP_257250526.1 | branched-chain amino acid ABC transporter substrate-binding protein | - |
| NQK75_RS20510 | 794459..794983 | + | 525 | WP_257250527.1 | L-2-amino-thiazoline-4-carboxylic acid hydrolase | - |
| NQK75_RS20515 | 794976..796241 | + | 1266 | WP_059677103.1 | Zn-dependent hydrolase | - |
| NQK75_RS20520 | 796329..796811 | - | 483 | WP_048026029.1 | GNAT family N-acetyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 122 a.a. Molecular weight: 13448.50 Da Isoelectric Point: 8.4389
>T253429 WP_021160897.1 NZ_CP102330:c791856-791491 [Burkholderia cepacia]
MVKALFDTNILIDYLGGVESARAELGRYDYRAISTISWMEVLVGTSAQDEAPIRAWLSSFDVIALDSPVANRAVTIRKER
RIRLPDAIVWASAQVNGLLLVSRNTKDFPATEPGVRVPYKL
MVKALFDTNILIDYLGGVESARAELGRYDYRAISTISWMEVLVGTSAQDEAPIRAWLSSFDVIALDSPVANRAVTIRKER
RIRLPDAIVWASAQVNGLLLVSRNTKDFPATEPGVRVPYKL
Download Length: 366 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|