Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/upstrm_HI1419-dnstrm_HI1420 |
| Location | 409302..409922 | Replicon | chromosome |
| Accession | NZ_CP102330 | ||
| Organism | Burkholderia cepacia strain N3009-2YT | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | NQK75_RS18835 | Protein ID | WP_021157289.1 |
| Coordinates | 409605..409922 (-) | Length | 106 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | U2GAF3 |
| Locus tag | NQK75_RS18830 | Protein ID | WP_021157290.1 |
| Coordinates | 409302..409601 (-) | Length | 100 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NQK75_RS18805 | 404416..405687 | + | 1272 | WP_059857507.1 | anthranilate 1,2-dioxygenase large subunit AndAc | - |
| NQK75_RS18810 | 405705..406190 | + | 486 | WP_048022184.1 | anthranilate 1,2-dioxygenase small subunit AndAd | - |
| NQK75_RS18815 | 406211..406537 | + | 327 | WP_006479527.1 | anthranilate 1,2-dioxygenase ferredoxin subunit AndAb | - |
| NQK75_RS18820 | 406527..407747 | + | 1221 | WP_257250406.1 | anthranilate 1,2-dioxygenase system ferredoxin--NAD(+) reductase | - |
| NQK75_RS18825 | 407959..409245 | + | 1287 | WP_257250408.1 | DUF445 domain-containing protein | - |
| NQK75_RS18830 | 409302..409601 | - | 300 | WP_021157290.1 | putative addiction module antidote protein | Antitoxin |
| NQK75_RS18835 | 409605..409922 | - | 318 | WP_021157289.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NQK75_RS18840 | 410283..411923 | + | 1641 | WP_021157288.1 | acetolactate synthase large subunit | - |
| NQK75_RS18845 | 411952..413385 | + | 1434 | WP_257250409.1 | aldehyde dehydrogenase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 11866.62 Da Isoelectric Point: 9.9423
>T253428 WP_021157289.1 NZ_CP102330:c409922-409605 [Burkholderia cepacia]
MPYSAPTFSIRTTDVFDAWFAGLRDRVAKRRIQARIDRLSMGNPGDWKSAGSPVVEMRIDHGPGYRVYYVRRGTIWVILL
CGGDKSTQQADIRAAHAMLAHLDME
MPYSAPTFSIRTTDVFDAWFAGLRDRVAKRRIQARIDRLSMGNPGDWKSAGSPVVEMRIDHGPGYRVYYVRRGTIWVILL
CGGDKSTQQADIRAAHAMLAHLDME
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|