Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 1823170..1823843 | Replicon | chromosome |
| Accession | NZ_CP102329 | ||
| Organism | Burkholderia cepacia strain N3009-2YT | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | - |
| Locus tag | NQK75_RS08430 | Protein ID | WP_257248282.1 |
| Coordinates | 1823427..1823843 (+) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | U2FLJ7 |
| Locus tag | NQK75_RS08425 | Protein ID | WP_021160097.1 |
| Coordinates | 1823170..1823430 (+) | Length | 87 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NQK75_RS08410 | 1818725..1820977 | + | 2253 | WP_257248280.1 | TonB-dependent siderophore receptor | - |
| NQK75_RS08415 | 1821064..1821903 | + | 840 | WP_042975471.1 | formyltransferase family protein | - |
| NQK75_RS08420 | 1821903..1822919 | + | 1017 | WP_257248281.1 | GNAT family N-acetyltransferase | - |
| NQK75_RS08425 | 1823170..1823430 | + | 261 | WP_021160097.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| NQK75_RS08430 | 1823427..1823843 | + | 417 | WP_257248282.1 | PIN domain-containing protein | Toxin |
| NQK75_RS08435 | 1823892..1824797 | - | 906 | WP_257248283.1 | nucleotidyl transferase AbiEii/AbiGii toxin family protein | - |
| NQK75_RS08440 | 1824766..1825839 | - | 1074 | WP_257249754.1 | type IV toxin-antitoxin system AbiEi family antitoxin | - |
| NQK75_RS08445 | 1826180..1827343 | + | 1164 | WP_059484570.1 | M20 aminoacylase family protein | - |
| NQK75_RS08450 | 1827587..1828126 | + | 540 | WP_257248284.1 | outer membrane protein assembly factor BamE | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 14545.76 Da Isoelectric Point: 7.2147
>T253427 WP_257248282.1 NZ_CP102329:1823427-1823843 [Burkholderia cepacia]
VTTLYMLDTNICSFIMRERPPVVLSRLQSCVNAQHRIVMSAITYAEMRFGAVGRKASPKHAELVTAFVSRLDGVLSWDTA
AVDATAAICADLAARGMPIGANDASIAGHAIAAGAVLVTNNGREFGRVAGLSLEDWAA
VTTLYMLDTNICSFIMRERPPVVLSRLQSCVNAQHRIVMSAITYAEMRFGAVGRKASPKHAELVTAFVSRLDGVLSWDTA
AVDATAAICADLAARGMPIGANDASIAGHAIAAGAVLVTNNGREFGRVAGLSLEDWAA
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|