Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | vapC-vagC/VapC-VagC |
Location | 175314..175951 | Replicon | chromosome |
Accession | NZ_CP102329 | ||
Organism | Burkholderia cepacia strain N3009-2YT |
Toxin (Protein)
Gene name | vapC | Uniprot ID | U2FRJ0 |
Locus tag | NQK75_RS00775 | Protein ID | WP_021164186.1 |
Coordinates | 175550..175951 (+) | Length | 134 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | - |
Locus tag | NQK75_RS00770 | Protein ID | WP_042978332.1 |
Coordinates | 175314..175550 (+) | Length | 79 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NQK75_RS00755 | 170924..171955 | + | 1032 | WP_124589456.1 | helix-turn-helix domain-containing protein | - |
NQK75_RS00760 | 172089..173201 | - | 1113 | WP_257248891.1 | ADP-heptose--LPS heptosyltransferase | - |
NQK75_RS00765 | 173198..174901 | - | 1704 | WP_059678233.1 | thiamine pyrophosphate-binding protein | - |
NQK75_RS00770 | 175314..175550 | + | 237 | WP_042978332.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
NQK75_RS00775 | 175550..175951 | + | 402 | WP_021164186.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
NQK75_RS00780 | 176019..177407 | - | 1389 | WP_021164187.1 | L-serine ammonia-lyase | - |
NQK75_RS00785 | 177438..178574 | - | 1137 | WP_060049042.1 | alginate lyase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 134 a.a. Molecular weight: 15033.14 Da Isoelectric Point: 5.2050
>T253426 WP_021164186.1 NZ_CP102329:175550-175951 [Burkholderia cepacia]
MPRYMLDTNMCIYLMKHQPEQVAKRFAQCYTGDVVMSAITYAELEYGVAACANAVRERRNLADLIEDIPVAPFDAAAAQA
YGPVREATRERKRDHLDKLIAAHAVSLDVVLVTNNERDFASYPGLRLENWLND
MPRYMLDTNMCIYLMKHQPEQVAKRFAQCYTGDVVMSAITYAELEYGVAACANAVRERRNLADLIEDIPVAPFDAAAAQA
YGPVREATRERKRDHLDKLIAAHAVSLDVVLVTNNERDFASYPGLRLENWLND
Download Length: 402 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|