Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/ParE-RHH |
Location | 1990190..1990730 | Replicon | chromosome |
Accession | NZ_CP102294 | ||
Organism | Alistipes ihumii AP11 |
Toxin (Protein)
Gene name | parE | Uniprot ID | - |
Locus tag | NQ491_RS08075 | Protein ID | WP_019246687.1 |
Coordinates | 1990431..1990730 (+) | Length | 100 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | - |
Locus tag | NQ491_RS08070 | Protein ID | WP_019246688.1 |
Coordinates | 1990190..1990438 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NQ491_RS08050 (NQ491_08050) | 1986158..1986613 | - | 456 | WP_147524764.1 | hypothetical protein | - |
NQ491_RS08055 (NQ491_08055) | 1986778..1987341 | - | 564 | WP_147524763.1 | hypothetical protein | - |
NQ491_RS08060 (NQ491_08060) | 1988378..1988701 | + | 324 | WP_019246690.1 | hypothetical protein | - |
NQ491_RS08065 (NQ491_08065) | 1989125..1990036 | + | 912 | WP_187119335.1 | hypothetical protein | - |
NQ491_RS08070 (NQ491_08070) | 1990190..1990438 | + | 249 | WP_019246688.1 | type II toxin-antitoxin system ParD family antitoxin | Antitoxin |
NQ491_RS08075 (NQ491_08075) | 1990431..1990730 | + | 300 | WP_019246687.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NQ491_RS08080 (NQ491_08080) | 1991064..1991348 | + | 285 | WP_019246686.1 | hypothetical protein | - |
NQ491_RS08085 (NQ491_08085) | 1991740..1992102 | + | 363 | WP_019246685.1 | hypothetical protein | - |
NQ491_RS08090 (NQ491_08090) | 1992105..1994744 | + | 2640 | WP_019246684.1 | PL29 family lyase N-terminal domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 1988378..1996539 | 8161 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11660.37 Da Isoelectric Point: 7.3808
>T253419 WP_019246687.1 NZ_CP102294:1990431-1990730 [Alistipes ihumii AP11]
MAEYRFTRKAVEDLSDIWHYTLETWSQKQADRYYRMLIECCRNIAEHPLAGRHYAEMAEGVYGLRAGKHIVFYRIAAPNE
IEVIRILHGSMDLKTRVGE
MAEYRFTRKAVEDLSDIWHYTLETWSQKQADRYYRMLIECCRNIAEHPLAGRHYAEMAEGVYGLRAGKHIVFYRIAAPNE
IEVIRILHGSMDLKTRVGE
Download Length: 300 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|