Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/YafQ-DinJ |
Location | 1763769..1764300 | Replicon | chromosome |
Accession | NZ_CP102293 | ||
Organism | Subdoligranulum variabile strain DSM 15176 |
Toxin (Protein)
Gene name | relE | Uniprot ID | D1PSN4 |
Locus tag | NQ490_RS08465 | Protein ID | WP_007048762.1 |
Coordinates | 1763769..1764041 (-) | Length | 91 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | NQ490_RS08470 | Protein ID | WP_040918972.1 |
Coordinates | 1764028..1764300 (-) | Length | 91 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NQ490_RS08445 (NQ490_08445) | 1759266..1759709 | + | 444 | WP_040918496.1 | phage holin family protein | - |
NQ490_RS08450 (NQ490_08450) | 1759898..1761115 | + | 1218 | WP_007048273.1 | BTAD domain-containing putative transcriptional regulator | - |
NQ490_RS08455 (NQ490_08455) | 1761182..1762855 | - | 1674 | WP_007048272.1 | phospho-sugar mutase | - |
NQ490_RS08465 (NQ490_08465) | 1763769..1764041 | - | 273 | WP_007048762.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
NQ490_RS08470 (NQ490_08470) | 1764028..1764300 | - | 273 | WP_040918972.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
NQ490_RS08475 (NQ490_08475) | 1764543..1765388 | - | 846 | WP_007048760.1 | hypothetical protein | - |
NQ490_RS08480 (NQ490_08480) | 1765424..1766395 | - | 972 | WP_007048759.1 | helix-turn-helix domain-containing protein | - |
NQ490_RS08485 (NQ490_08485) | 1766458..1768326 | - | 1869 | WP_040918970.1 | type IV secretory system conjugative DNA transfer family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 1748290..1799210 | 50920 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 91 a.a. Molecular weight: 10630.30 Da Isoelectric Point: 7.2405
>T253418 WP_007048762.1 NZ_CP102293:c1764041-1763769 [Subdoligranulum variabile]
MLTIKYQAAFKKDYKRIVKRGYDMRLLEKVIELLANQKPLPEKNRDHQLSGDYAGCRECHITPDWLLIYEVADEELILYL
TRTGSHSDLF
MLTIKYQAAFKKDYKRIVKRGYDMRLLEKVIELLANQKPLPEKNRDHQLSGDYAGCRECHITPDWLLIYEVADEELILYL
TRTGSHSDLF
Download Length: 273 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|