Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/YafQ-DinJ |
Location | 227390..227955 | Replicon | chromosome |
Accession | NZ_CP102293 | ||
Organism | Subdoligranulum variabile strain DSM 15176 |
Toxin (Protein)
Gene name | relE | Uniprot ID | D1PML0 |
Locus tag | NQ490_RS01090 | Protein ID | WP_007046955.1 |
Coordinates | 227390..227680 (-) | Length | 97 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | NQ490_RS01095 | Protein ID | WP_040917696.1 |
Coordinates | 227677..227955 (-) | Length | 93 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NQ490_RS01055 (NQ490_01055) | 222431..223012 | - | 582 | WP_040917689.1 | helix-turn-helix transcriptional regulator | - |
NQ490_RS01060 (NQ490_01060) | 223184..223435 | + | 252 | WP_040917692.1 | helix-turn-helix transcriptional regulator | - |
NQ490_RS01065 (NQ490_01065) | 223509..224345 | + | 837 | WP_040917694.1 | hypothetical protein | - |
NQ490_RS01075 (NQ490_01075) | 225124..225545 | - | 422 | Protein_203 | hypothetical protein | - |
NQ490_RS01080 (NQ490_01080) | 225614..226396 | - | 783 | Protein_204 | DNA methylase | - |
NQ490_RS01085 (NQ490_01085) | 227127..227324 | + | 198 | WP_007046954.1 | helix-turn-helix domain-containing protein | - |
NQ490_RS01090 (NQ490_01090) | 227390..227680 | - | 291 | WP_007046955.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
NQ490_RS01095 (NQ490_01095) | 227677..227955 | - | 279 | WP_040917696.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
NQ490_RS01100 (NQ490_01100) | 228462..228656 | + | 195 | WP_040918082.1 | helix-turn-helix domain-containing protein | - |
NQ490_RS01105 (NQ490_01105) | 228841..230040 | + | 1200 | WP_242654987.1 | site-specific integrase | - |
NQ490_RS01115 (NQ490_01115) | 230821..232431 | - | 1611 | WP_007046961.1 | potassium/proton antiporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 97 a.a. Molecular weight: 11128.12 Da Isoelectric Point: 10.0678
>T253417 WP_007046955.1 NZ_CP102293:c227680-227390 [Subdoligranulum variabile]
MSQTKYVVKFTTQFRKDYKLAMKRGLKIELLERIIMLLAAGETLPKKSKDHALTGNWVGHRECHILPDWLLVYRVEDDVL
VLTLTRTGTHSDLFGK
MSQTKYVVKFTTQFRKDYKLAMKRGLKIELLERIIMLLAAGETLPKKSKDHALTGNWVGHRECHILPDWLLVYRVEDDVL
VLTLTRTGTHSDLFGK
Download Length: 291 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|