253416

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC-VagC
Location 138701..139329 Replicon chromosome
Accession NZ_CP102292
Organism [Ruminococcus] lactaris ATCC 29176

Toxin (Protein)


Gene name vapC Uniprot ID B5CQ10
Locus tag NQ541_RS00745 Protein ID WP_005611381.1
Coordinates 138928..139329 (+) Length 134 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID B5CQ11
Locus tag NQ541_RS00740 Protein ID WP_005611383.1
Coordinates 138701..138931 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NQ541_RS00710 (NQ541_00710) 135212..135565 - 354 WP_005611390.1 hypothetical protein -
NQ541_RS00715 (NQ541_00715) 135725..136354 - 630 WP_023921480.1 PrsW family glutamic-type intramembrane protease -
NQ541_RS00720 (NQ541_00720) 136351..136977 - 627 WP_023921482.1 hypothetical protein -
NQ541_RS00725 (NQ541_00725) 136964..137326 - 363 WP_005611385.1 DUF4179 domain-containing protein -
NQ541_RS00730 (NQ541_00730) 137313..137861 - 549 WP_023921484.1 sigma-70 family RNA polymerase sigma factor -
NQ541_RS00735 (NQ541_00735) 137915..138124 - 210 WP_023921485.1 helix-turn-helix domain-containing protein -
NQ541_RS00740 (NQ541_00740) 138701..138931 + 231 WP_005611383.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
NQ541_RS00745 (NQ541_00745) 138928..139329 + 402 WP_005611381.1 type II toxin-antitoxin system VapC family toxin Toxin
NQ541_RS00750 (NQ541_00750) 139635..139877 - 243 Protein_145 macro domain-containing protein -
NQ541_RS00755 (NQ541_00755) 139905..140762 - 858 WP_233417830.1 hypothetical protein -
NQ541_RS00760 (NQ541_00760) 140920..141030 + 111 Protein_147 transposase -
NQ541_RS00765 (NQ541_00765) 141268..141822 - 555 WP_005611368.1 hypothetical protein -
NQ541_RS00770 (NQ541_00770) 141812..142111 - 300 WP_147644452.1 DNA cytosine methyltransferase -
NQ541_RS00775 (NQ541_00775) 142535..142765 + 231 WP_005611353.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 116175..146939 30764


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(3-124)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 134 a.a.        Molecular weight: 14958.30 Da        Isoelectric Point: 6.7140

>T253416 WP_005611381.1 NZ_CP102292:138928-139329 [[Ruminococcus] lactaris ATCC 29176]
MRYMLDTNICIYAIKKKPEEVFRRLQQHDPSEVCISAVTYAELMHGVEKSKAVEKNRLALTLLLANIEILDFDSLAAESY
GKIRADLEKAGTPIGPLDMMIAGHAQSLGYTVVTNNTKEFDRVKSLKVENWAN

Download         Length: 402 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8798.98 Da        Isoelectric Point: 4.4012

>AT253416 WP_005611383.1 NZ_CP102292:138701-138931 [[Ruminococcus] lactaris ATCC 29176]
MMTAKVFENGRSQAVRLPKECRFATDEVVVNRIGDIVLLMPNTNRWSSFLQAVDLFSDDFMETGRNQGMEQEREEL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A414P1V1

Antitoxin

Source ID Structure
AlphaFold DB A0A414P1J8

References