Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 138701..139329 | Replicon | chromosome |
| Accession | NZ_CP102292 | ||
| Organism | [Ruminococcus] lactaris ATCC 29176 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | B5CQ10 |
| Locus tag | NQ541_RS00745 | Protein ID | WP_005611381.1 |
| Coordinates | 138928..139329 (+) | Length | 134 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | B5CQ11 |
| Locus tag | NQ541_RS00740 | Protein ID | WP_005611383.1 |
| Coordinates | 138701..138931 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NQ541_RS00710 (NQ541_00710) | 135212..135565 | - | 354 | WP_005611390.1 | hypothetical protein | - |
| NQ541_RS00715 (NQ541_00715) | 135725..136354 | - | 630 | WP_023921480.1 | PrsW family glutamic-type intramembrane protease | - |
| NQ541_RS00720 (NQ541_00720) | 136351..136977 | - | 627 | WP_023921482.1 | hypothetical protein | - |
| NQ541_RS00725 (NQ541_00725) | 136964..137326 | - | 363 | WP_005611385.1 | DUF4179 domain-containing protein | - |
| NQ541_RS00730 (NQ541_00730) | 137313..137861 | - | 549 | WP_023921484.1 | sigma-70 family RNA polymerase sigma factor | - |
| NQ541_RS00735 (NQ541_00735) | 137915..138124 | - | 210 | WP_023921485.1 | helix-turn-helix domain-containing protein | - |
| NQ541_RS00740 (NQ541_00740) | 138701..138931 | + | 231 | WP_005611383.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| NQ541_RS00745 (NQ541_00745) | 138928..139329 | + | 402 | WP_005611381.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| NQ541_RS00750 (NQ541_00750) | 139635..139877 | - | 243 | Protein_145 | macro domain-containing protein | - |
| NQ541_RS00755 (NQ541_00755) | 139905..140762 | - | 858 | WP_233417830.1 | hypothetical protein | - |
| NQ541_RS00760 (NQ541_00760) | 140920..141030 | + | 111 | Protein_147 | transposase | - |
| NQ541_RS00765 (NQ541_00765) | 141268..141822 | - | 555 | WP_005611368.1 | hypothetical protein | - |
| NQ541_RS00770 (NQ541_00770) | 141812..142111 | - | 300 | WP_147644452.1 | DNA cytosine methyltransferase | - |
| NQ541_RS00775 (NQ541_00775) | 142535..142765 | + | 231 | WP_005611353.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 116175..146939 | 30764 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 134 a.a. Molecular weight: 14958.30 Da Isoelectric Point: 6.7140
>T253416 WP_005611381.1 NZ_CP102292:138928-139329 [[Ruminococcus] lactaris ATCC 29176]
MRYMLDTNICIYAIKKKPEEVFRRLQQHDPSEVCISAVTYAELMHGVEKSKAVEKNRLALTLLLANIEILDFDSLAAESY
GKIRADLEKAGTPIGPLDMMIAGHAQSLGYTVVTNNTKEFDRVKSLKVENWAN
MRYMLDTNICIYAIKKKPEEVFRRLQQHDPSEVCISAVTYAELMHGVEKSKAVEKNRLALTLLLANIEILDFDSLAAESY
GKIRADLEKAGTPIGPLDMMIAGHAQSLGYTVVTNNTKEFDRVKSLKVENWAN
Download Length: 402 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A414P1V1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A414P1J8 |