Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relE-yefM/YoeB-RelB |
| Location | 1427899..1428421 | Replicon | chromosome |
| Accession | NZ_CP102277 | ||
| Organism | Coprococcus comes ATCC 27758 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | NQ556_RS07020 | Protein ID | WP_147574863.1 |
| Coordinates | 1428158..1428421 (+) | Length | 88 a.a. |
Antitoxin (Protein)
| Gene name | yefM | Uniprot ID | C0B4N5 |
| Locus tag | NQ556_RS07015 | Protein ID | WP_008372201.1 |
| Coordinates | 1427899..1428165 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NQ556_RS06985 (NQ556_06985) | 1422946..1424244 | - | 1299 | WP_022219878.1 | nucleotidyltransferase | - |
| NQ556_RS06990 (NQ556_06990) | 1424445..1425632 | + | 1188 | WP_008372212.1 | acetate kinase | - |
| NQ556_RS06995 (NQ556_06995) | 1425730..1426257 | + | 528 | WP_008372210.1 | DUF177 domain-containing protein | - |
| NQ556_RS07000 (NQ556_07000) | 1426261..1426443 | + | 183 | WP_008372209.1 | 50S ribosomal protein L32 | - |
| NQ556_RS07005 (NQ556_07005) | 1427106..1427345 | + | 240 | WP_008372205.1 | helix-turn-helix transcriptional regulator | - |
| NQ556_RS07010 (NQ556_07010) | 1427465..1427794 | + | 330 | WP_008372203.1 | nucleotidyltransferase domain-containing protein | - |
| NQ556_RS07015 (NQ556_07015) | 1427899..1428165 | + | 267 | WP_008372201.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| NQ556_RS07020 (NQ556_07020) | 1428158..1428421 | + | 264 | WP_147574863.1 | Txe/YoeB family addiction module toxin | Toxin |
| NQ556_RS07025 (NQ556_07025) | 1428456..1428671 | - | 216 | WP_008372198.1 | hypothetical protein | - |
| NQ556_RS07030 (NQ556_07030) | 1428951..1429196 | + | 246 | WP_008372194.1 | hypothetical protein | - |
| NQ556_RS07035 (NQ556_07035) | 1429469..1430536 | + | 1068 | WP_204575905.1 | phosphate acyltransferase PlsX | - |
| NQ556_RS07040 (NQ556_07040) | 1430558..1430788 | + | 231 | WP_008372189.1 | acyl carrier protein | - |
| NQ556_RS07045 (NQ556_07045) | 1430856..1431551 | + | 696 | WP_044998976.1 | ribonuclease III | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | - | 1416373..1580505 | 164132 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 88 a.a. Molecular weight: 10462.76 Da Isoelectric Point: 8.7936
>T253411 WP_147574863.1 NZ_CP102277:1428158-1428421 [Coprococcus comes ATCC 27758]
MNKVFTDNGWEDYTYWQTEDKKTLKKINNLIKDIDRNGNEGIGKPEPLTGNLTGFWSRRINDKDRLIYKIDDKNIYILSC
RYHYNDK
MNKVFTDNGWEDYTYWQTEDKKTLKKINNLIKDIDRNGNEGIGKPEPLTGNLTGFWSRRINDKDRLIYKIDDKNIYILSC
RYHYNDK
Download Length: 264 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|