Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/YafQ-DinJ |
Location | 1997821..1998371 | Replicon | chromosome |
Accession | NZ_CP102270 | ||
Organism | Butyrivibrio crossotus strain DSM 2876 |
Toxin (Protein)
Gene name | relE | Uniprot ID | D4RZ62 |
Locus tag | NQ527_RS09805 | Protein ID | WP_005602462.1 |
Coordinates | 1997821..1998102 (-) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | D4RZ63 |
Locus tag | NQ527_RS09810 | Protein ID | WP_005602465.1 |
Coordinates | 1998102..1998371 (-) | Length | 90 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NQ527_RS09775 (NQ527_09775) | 1993620..1993772 | - | 153 | WP_005602448.1 | cyclic lactone autoinducer peptide | - |
NQ527_RS09780 (NQ527_09780) | 1993803..1994414 | - | 612 | WP_005602449.1 | accessory gene regulator B family protein | - |
NQ527_RS09785 (NQ527_09785) | 1994469..1995737 | - | 1269 | WP_005602451.1 | GHKL domain-containing protein | - |
NQ527_RS09790 (NQ527_09790) | 1995737..1996468 | - | 732 | WP_040331897.1 | LytTR family DNA-binding domain-containing protein | - |
NQ527_RS09795 (NQ527_09795) | 1996693..1997298 | + | 606 | WP_005602455.1 | abortive infection protein | - |
NQ527_RS09800 (NQ527_09800) | 1997291..1997505 | + | 215 | Protein_1920 | nucleotidyl transferase AbiEii/AbiGii toxin family protein | - |
NQ527_RS09805 (NQ527_09805) | 1997821..1998102 | - | 282 | WP_005602462.1 | type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family | Toxin |
NQ527_RS09810 (NQ527_09810) | 1998102..1998371 | - | 270 | WP_005602465.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
NQ527_RS09815 (NQ527_09815) | 1998555..2000810 | - | 2256 | WP_040331899.1 | ABC transporter permease | - |
NQ527_RS09820 (NQ527_09820) | 2000821..2001519 | - | 699 | WP_005602469.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10960.88 Da Isoelectric Point: 8.0368
>T253408 WP_005602462.1 NZ_CP102270:c1998102-1997821 [Butyrivibrio crossotus]
MQYELILTGKFKKSLKLAKKRGLDLKLLDKVITMLQNDIPLEEKYRDHELKGKYQGFRECHIQPDWLLIYLKENDVLTLT
LVDTGTHADLFNL
MQYELILTGKFKKSLKLAKKRGLDLKLLDKVITMLQNDIPLEEKYRDHELKGKYQGFRECHIQPDWLLIYLKENDVLTLT
LVDTGTHADLFNL
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|