253403

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/YafQ-DinJ
Location 4422322..4422887 Replicon chromosome
Accession NZ_CP102267
Organism Blautia wexlerae DSM 19850

Toxin (Protein)


Gene name relE Uniprot ID C7H6P5
Locus tag NQ550_RS20635 Protein ID WP_002596328.1
Coordinates 4422597..4422887 (+) Length 97 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID C7H6P4
Locus tag NQ550_RS20630 Protein ID WP_005924829.1
Coordinates 4422322..4422600 (+) Length 93 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NQ550_RS20590 (NQ550_20590) 4417633..4417938 - 306 WP_002569240.1 hypothetical protein -
NQ550_RS20595 (NQ550_20595) 4418114..4418242 - 129 Protein_4038 Maff2 family protein -
NQ550_RS20600 (NQ550_20600) 4418488..4419327 - 840 Protein_4039 TraM recognition domain-containing protein -
NQ550_RS20605 (NQ550_20605) 4419414..4419779 - 366 WP_025577961.1 hypothetical protein -
NQ550_RS20610 (NQ550_20610) 4419857..4420051 - 195 WP_025577963.1 transposon-encoded TnpW family protein -
NQ550_RS20615 (NQ550_20615) 4420095..4420958 - 864 WP_025577965.1 ATP-binding protein -
NQ550_RS20620 (NQ550_20620) 4420955..4421683 - 729 WP_025577966.1 phage replisome organizer N-terminal domain-containing protein -
NQ550_RS20625 (NQ550_20625) 4421797..4422195 - 399 WP_081703195.1 cysteine-rich VLP domain-containing protein -
NQ550_RS20630 (NQ550_20630) 4422322..4422600 + 279 WP_005924829.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
NQ550_RS20635 (NQ550_20635) 4422597..4422887 + 291 WP_002596328.1 type II toxin-antitoxin system YafQ family toxin Toxin
NQ550_RS20640 (NQ550_20640) 4422995..4424440 - 1446 WP_025577970.1 MobQ family relaxase -
NQ550_RS20645 (NQ550_20645) 4424628..4424918 - 291 WP_025577972.1 DUF3847 domain-containing protein -
NQ550_RS20650 (NQ550_20650) 4424947..4425408 - 462 WP_009296689.1 sigma factor-like helix-turn-helix DNA-binding protein -
NQ550_RS20655 (NQ550_20655) 4425419..4425871 - 453 WP_025577976.1 hypothetical protein -
NQ550_RS20660 (NQ550_20660) 4425975..4426388 - 414 WP_025577978.1 sigma factor-like helix-turn-helix DNA-binding protein -
NQ550_RS20665 (NQ550_20665) 4426913..4427086 - 174 WP_081026450.1 cysteine-rich KTR domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 4401253..4448559 47306


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(8-94)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(5-90)


Sequences

Toxin        


Download         Length: 97 a.a.        Molecular weight: 11112.87 Da        Isoelectric Point: 8.0630

>T253403 WP_002596328.1 NZ_CP102267:4422597-4422887 [Blautia wexlerae DSM 19850]
MKETKYTVKYTTSFKKDYKRAIKRGLKIELLEQVVALLAMGEPLPDKNRDHDLSGDWAGHRECHILPDWLLVYRIEDDVL
VLTLARTGTHSDLFGK

Download         Length: 291 bp

Antitoxin


Download         Length: 93 a.a.        Molecular weight: 10247.66 Da        Isoelectric Point: 4.4692

>AT253403 WP_005924829.1 NZ_CP102267:4422322-4422600 [Blautia wexlerae DSM 19850]
MAGNTTNISIRMDADLKAQADALFTELGMNLTTAFNIFVRQSLREGGIPFEVRLEQPNKETVAAMLEAERIAKDPSVKGY
NDLDELFADLKR

Download         Length: 279 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1M4XBM1

Antitoxin

Source ID Structure
AlphaFold DB A0A1M4XB19

References