Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/YafQ-DinJ |
| Location | 4422322..4422887 | Replicon | chromosome |
| Accession | NZ_CP102267 | ||
| Organism | Blautia wexlerae DSM 19850 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | C7H6P5 |
| Locus tag | NQ550_RS20635 | Protein ID | WP_002596328.1 |
| Coordinates | 4422597..4422887 (+) | Length | 97 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | C7H6P4 |
| Locus tag | NQ550_RS20630 | Protein ID | WP_005924829.1 |
| Coordinates | 4422322..4422600 (+) | Length | 93 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NQ550_RS20590 (NQ550_20590) | 4417633..4417938 | - | 306 | WP_002569240.1 | hypothetical protein | - |
| NQ550_RS20595 (NQ550_20595) | 4418114..4418242 | - | 129 | Protein_4038 | Maff2 family protein | - |
| NQ550_RS20600 (NQ550_20600) | 4418488..4419327 | - | 840 | Protein_4039 | TraM recognition domain-containing protein | - |
| NQ550_RS20605 (NQ550_20605) | 4419414..4419779 | - | 366 | WP_025577961.1 | hypothetical protein | - |
| NQ550_RS20610 (NQ550_20610) | 4419857..4420051 | - | 195 | WP_025577963.1 | transposon-encoded TnpW family protein | - |
| NQ550_RS20615 (NQ550_20615) | 4420095..4420958 | - | 864 | WP_025577965.1 | ATP-binding protein | - |
| NQ550_RS20620 (NQ550_20620) | 4420955..4421683 | - | 729 | WP_025577966.1 | phage replisome organizer N-terminal domain-containing protein | - |
| NQ550_RS20625 (NQ550_20625) | 4421797..4422195 | - | 399 | WP_081703195.1 | cysteine-rich VLP domain-containing protein | - |
| NQ550_RS20630 (NQ550_20630) | 4422322..4422600 | + | 279 | WP_005924829.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| NQ550_RS20635 (NQ550_20635) | 4422597..4422887 | + | 291 | WP_002596328.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
| NQ550_RS20640 (NQ550_20640) | 4422995..4424440 | - | 1446 | WP_025577970.1 | MobQ family relaxase | - |
| NQ550_RS20645 (NQ550_20645) | 4424628..4424918 | - | 291 | WP_025577972.1 | DUF3847 domain-containing protein | - |
| NQ550_RS20650 (NQ550_20650) | 4424947..4425408 | - | 462 | WP_009296689.1 | sigma factor-like helix-turn-helix DNA-binding protein | - |
| NQ550_RS20655 (NQ550_20655) | 4425419..4425871 | - | 453 | WP_025577976.1 | hypothetical protein | - |
| NQ550_RS20660 (NQ550_20660) | 4425975..4426388 | - | 414 | WP_025577978.1 | sigma factor-like helix-turn-helix DNA-binding protein | - |
| NQ550_RS20665 (NQ550_20665) | 4426913..4427086 | - | 174 | WP_081026450.1 | cysteine-rich KTR domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 4401253..4448559 | 47306 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 97 a.a. Molecular weight: 11112.87 Da Isoelectric Point: 8.0630
>T253403 WP_002596328.1 NZ_CP102267:4422597-4422887 [Blautia wexlerae DSM 19850]
MKETKYTVKYTTSFKKDYKRAIKRGLKIELLEQVVALLAMGEPLPDKNRDHDLSGDWAGHRECHILPDWLLVYRIEDDVL
VLTLARTGTHSDLFGK
MKETKYTVKYTTSFKKDYKRAIKRGLKIELLEQVVALLAMGEPLPDKNRDHDLSGDWAGHRECHILPDWLLVYRIEDDVL
VLTLARTGTHSDLFGK
Download Length: 291 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1M4XBM1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1M4XB19 |